DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tw and Sdf2l1

DIOPT Version :9

Sequence 1:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001102903.1 Gene:Sdf2l1 / 680945 RGDID:1585844 Length:220 Species:Rattus norvegicus


Alignment Length:225 Identity:73/225 - (32%)
Similarity:109/225 - (48%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 LYILFFYIHLSVLNRSGNGDGFYSSAFQSRLIGNSLYNASMPRDVAYGSLVTIKN--HKTGGGYL 339
            |.:|...:.|||  |||               |.|..:|.:   |..||::.:.|  |:.   .|
  Rat    11 LTLLGLLLALSV--RSG---------------GASKASAGL---VTCGSVLKLLNTHHRV---RL 52

  Fly   340 HSHHHLYPKGSGARQQQVTTYTHKDE-NNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMATRRN 403
            |||...|  |||:.||.||.....|: |:.|.||..::.|.|:|..  :|.|..|||||:.|.:|
  Rat    53 HSHDIKY--GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGLP--VRCGQAVRLTHVLTGKN 113

  Fly   404 LHSHNEPAPMTKKHLQVTGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTS 468
            ||:|:.|:|::... :|:.:||.|.||..|:|.|...|.....     .:.::|.|:..:..|:.
  Rat   114 LHTHHFPSPLSNNQ-EVSAFGEDGEGDDLDLWTVRCSGQHWER-----EASVRFQHVGTSVFLSV 172

  Fly   469 SGKQL--PKWGFEQQEVSCNPNVRDKNSQW 496
            :|:|.  |..|  |.||...|:....|: |
  Rat   173 TGEQYGNPIRG--QHEVHGMPSANAHNT-W 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twNP_001259102.1 PMT1 41..765 CDD:224839 73/225 (32%)
PMT 44..290 CDD:280519 5/12 (42%)
MIR 318..374 CDD:197746 22/58 (38%)
MIR 385..440 CDD:197746 23/54 (43%)
MIR 446..501 CDD:197746 13/53 (25%)
PMT_4TMC 518..763 CDD:292810
Sdf2l1NP_001102903.1 PMT1 <52..>199 CDD:224839 56/159 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.