DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tw and sdf2

DIOPT Version :9

Sequence 1:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001016483.1 Gene:sdf2 / 549237 XenbaseID:XB-GENE-489307 Length:218 Species:Xenopus tropicalis


Alignment Length:179 Identity:63/179 - (35%)
Similarity:93/179 - (51%) Gaps:13/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 VAYGSLVTIKNHKTGGGYLHSHHHLYPKGSGARQQQVTTYTHKDENNK-WLIRPHNKPGPPKGKV 384
            |..||:|.:.|.| ....||||...|  |||:.||.||..|..|:.|. |.||........:|| 
 Frog    31 VTCGSVVKLLNIK-HSVRLHSHDVRY--GSGSGQQSVTGVTSVDDGNSYWRIRGQTSTVCERGK- 91

  Fly   385 QILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQVTGYGELGLGDANDVWRVLIVGGKVNETVH 449
             :::.|..|||||:.|.||||||:..:|::... :|:.:|:.|.||..|.|.|| .||:..:.  
 Frog    92 -LIKCGQSVRLTHVNTGRNLHSHHFTSPLSGNQ-EVSAFGDDGEGDILDDWTVL-CGGEFWQR-- 151

  Fly   450 TVTSRLKFIHLLQNCALTSSGKQLPKWGFEQQEVSCNPNVRDKNSQWNV 498
              ...::|.|...:..|:.:|:|..:....|:||. ..:..::||.|.|
 Frog   152 --DDEVRFRHTSTSVFLSVTGEQYGRPINGQREVH-GMSYANQNSYWKV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twNP_001259102.1 PMT1 41..765 CDD:224839 63/179 (35%)
PMT 44..290 CDD:280519
MIR 318..374 CDD:197746 24/53 (45%)
MIR 385..440 CDD:197746 23/54 (43%)
MIR 446..501 CDD:197746 12/53 (23%)
PMT_4TMC 518..763 CDD:292810
sdf2NP_001016483.1 MIR 30..79 CDD:197746 22/50 (44%)
MIR 39..183 CDD:280906 53/154 (34%)
MIR 90..144 CDD:197746 25/57 (44%)
MIR 146..199 CDD:197746 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.