DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tw and sdf2l1

DIOPT Version :9

Sequence 1:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001003730.2 Gene:sdf2l1 / 445275 ZFINID:ZDB-GENE-040808-46 Length:218 Species:Danio rerio


Alignment Length:208 Identity:72/208 - (34%)
Similarity:102/208 - (49%) Gaps:26/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SAFQSRLIGNSLYNASMPRDV--AY---GSLVTIKN--HKTGGGYLHSHHHLYPKGSGARQQQVT 358
            |.|...::...:::....|||  :|   ||||.:.|  |..   .||||...|  |||:.||.||
Zfish     9 SVFLDLILVCLVFSPCGARDVDSSYVTCGSLVKLMNTRHSV---RLHSHDVKY--GSGSGQQSVT 68

  Fly   359 TYTHKDE-NNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQVTG 422
            .....|: |:.|.||  .|||....:...:|.|..:|:|||.|.||||||:..:|:: .|.:|:.
Zfish    69 GVDSADDANSYWRIR--GKPGSICQRGAPIRCGQAIRITHMTTGRNLHSHHFSSPLS-NHQEVSA 130

  Fly   423 YGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQL--PKWGFEQQEVSC 485
            :||.|.||..|||.|     :.:.|.......::|.|......|:.:|:|.  |..|  |:||..
Zfish   131 FGENGEGDDLDVWNV-----QCSATYWDREDAVRFKHTGTEVFLSVTGEQYGHPIRG--QREVHG 188

  Fly   486 NPNVRDKNSQWNV 498
            .|:....| .|.|
Zfish   189 MPSPNQHN-YWKV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twNP_001259102.1 PMT1 41..765 CDD:224839 72/208 (35%)
PMT 44..290 CDD:280519
MIR 318..374 CDD:197746 27/63 (43%)
MIR 385..440 CDD:197746 25/54 (46%)
MIR 446..501 CDD:197746 15/55 (27%)
PMT_4TMC 518..763 CDD:292810
sdf2l1NP_001003730.2 MIR 33..82 CDD:197746 22/53 (42%)
MIR 93..148 CDD:197746 25/60 (42%)
MIR 156..202 CDD:197746 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.