DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tw and SDF2L1

DIOPT Version :9

Sequence 1:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_071327.2 Gene:SDF2L1 / 23753 HGNCID:10676 Length:221 Species:Homo sapiens


Alignment Length:242 Identity:76/242 - (31%)
Similarity:115/242 - (47%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 WPVLLYILFFYIHLSVLNRSGNGDGFYSSAFQSRLIGNSLYNASMPRDVAYGSLVTIKN--HKTG 335
            |||||.:|     |::|...|               |.:...|.:   |..||::.:.|  |:. 
Human    11 WPVLLGLL-----LALLVPGG---------------GAAKTGAEL---VTCGSVLKLLNTHHRV- 51

  Fly   336 GGYLHSHHHLYPKGSGARQQQVTTYTHKDE-NNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMA 399
              .||||...|  |||:.||.||.....|: |:.|.||..::.|.|:|..  :|.|..|||||:.
Human    52 --RLHSHDIKY--GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGSP--VRCGQAVRLTHVL 110

  Fly   400 TRRNLHSHNEPAPMTKKHLQVTGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNC 464
            |.:|||:|:.|:|::... :|:.:||.|.||..|:|.|...|.....     .:.::|.|:..:.
Human   111 TGKNLHTHHFPSPLSNNQ-EVSAFGEDGEGDDLDLWTVRCSGQHWER-----EAAVRFQHVGTSV 169

  Fly   465 ALTSSGKQL--PKWGFEQQEVSCNPNVRDKNSQWNVEDNEHKLMPSV 509
            .|:.:|:|.  |..|  |.||...|:....|: |...:... :.|||
Human   170 FLSVTGEQYGSPIRG--QHEVHGMPSANTHNT-WKAMEGIF-IKPSV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twNP_001259102.1 PMT1 41..765 CDD:224839 76/242 (31%)
PMT 44..290 CDD:280519 7/16 (44%)
MIR 318..374 CDD:197746 22/58 (38%)
MIR 385..440 CDD:197746 23/54 (43%)
MIR 446..501 CDD:197746 13/56 (23%)
PMT_4TMC 518..763 CDD:292810
SDF2L1NP_071327.2 PMT_4TMC <53..>200 CDD:330524 56/159 (35%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 218..221
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.