DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tw and R12E2.13

DIOPT Version :9

Sequence 1:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_491320.1 Gene:R12E2.13 / 172010 WormBaseID:WBGene00020038 Length:206 Species:Caenorhabditis elegans


Alignment Length:166 Identity:53/166 - (31%)
Similarity:81/166 - (48%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 GGYLHSHHHLYPKGSGARQQQVTTYTHKDE-NNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMA 399
            |..||||...|  |||:.||.||...:.|: |:.|.|.|.......:|  ..::.||.:||.|:.
 Worm    40 GSRLHSHDVKY--GSGSGQQSVTAVKNSDDINSHWQIFPALNAKCNRG--DAIKCGDKIRLKHLT 100

  Fly   400 TRRNLHSHNEPAPMTKKHLQVTGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNC 464
            |...||||:..||::|:|.:|:.:|.....|..|.|.|:..|.:..|     :.:.|..|.:...
 Worm   101 TGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVICNGDEWLE-----SEQFKLRHAVTGS 160

  Fly   465 ALTSSGKQLPKWGFEQQEVSCNPNVRDKNSQWNVED 500
            .|:.||:|..:....|:||....::.. .|.|.|.:
 Worm   161 YLSLSGQQFGRPIHGQREVVGTDSITG-GSAWKVAE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twNP_001259102.1 PMT1 41..765 CDD:224839 53/166 (32%)
PMT 44..290 CDD:280519
MIR 318..374 CDD:197746 17/38 (45%)
MIR 385..440 CDD:197746 20/54 (37%)
MIR 446..501 CDD:197746 13/55 (24%)
PMT_4TMC 518..763 CDD:292810
R12E2.13NP_491320.1 MIR 23..77 CDD:197746 17/38 (45%)
MIR 34..180 CDD:280906 49/148 (33%)
MIR 85..141 CDD:197746 21/57 (37%)
MIR 143..195 CDD:197746 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1660
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.