DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Sfrp1

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001263641.2 Gene:Sfrp1 / 84402 RGDID:621074 Length:314 Species:Rattus norvegicus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:89/253 - (35%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL- 199
            |.|.:..|||:...|....:..|||...|:|   :.||:..|:.|||.||..|     ..:|:. 
  Rat    91 KQQASSWVPLLNKNCHMGTQVFLCSLFAPVC---LDRPIYPCRWLCEAVRDSC-----EPVMQFF 147

  Fly   200 ---WPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTS 261
               ||..|.||..|:   .::|:.:....|.....|.|  ||..|..:                :
  Rat   148 GFYWPEMLKCDKFPE---GDVCIAMTPPNATEASKPQG--TTVCPPCD----------------N 191

  Fly   262 DLAGVLCPQNFSGSPFNPEECVPQCQRDAFHTSSQKKTSETLILGLSAVCFVLTLFALVTFWAEP 326
            :|......::...|.|.....:.:.:::........|..:.|.||                   |
  Rat   192 ELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLG-------------------P 237

  Fly   327 TRFGYPERPVLFL-----CLCYNLFSVCYLERIVFHNQARMHDVELQWRLMRPGCLLT 379
            .:....:|.||||     |.|:.|.::             .|:..:..|.::...|||
  Rat   238 IKKKELKRLVLFLKNGADCPCHQLDNL-------------SHNFLIMGRKVKSQYLLT 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 27/89 (30%)
Frizzled 291..584 CDD:279827 18/94 (19%)
Sfrp1NP_001263641.2 CRD_SFRP1 52..175 CDD:143552 28/94 (30%)
NTR_Sfrp1_like 183..306 CDD:239635 24/148 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.