DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Cpz

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_038948430.1 Gene:Cpz / 83575 RGDID:620496 Length:660 Species:Rattus norvegicus


Alignment Length:126 Identity:42/126 - (33%)
Similarity:56/126 - (44%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LIESGCSRRARFLLCSSLFPLCT-PDVPRPVAACKLLCETVRGECMENAPPELMELWPSFLNCDG 208
            |:|..|:...|.|.||.|.|.|. ....||   |:.:||.:|..| :.|...:...||.||:|..
  Rat    99 LLEGQCNPDLRLLGCSVLAPRCQGGHTQRP---CRRVCEGLREAC-QPAFDAIDMAWPYFLDCTQ 159

  Fly   209 LPQPEKHELCM----QIPQEVAVPGGSPSG-PPTTGSPGVEDHPQTYRFWKSGASPTSDLA 264
            ...||: |.|.    |:..|:.|....||| |||........:.|..|..|..|:..|.:|
  Rat   160 YFAPEE-EGCYDPLEQLRGELDVEEALPSGLPPTFIRFAHHSYAQMVRVLKRTAARCSQVA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 28/83 (34%)
Frizzled 291..584 CDD:279827
CpzXP_038948430.1 CRD_FZ 51..178 CDD:413323 28/83 (34%)
M14_CPZ 198..512 CDD:349439 6/22 (27%)
Peptidase_M14NE-CP-C_like 516..592 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.