DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fz3 and MFRP

DIOPT Version :9

Sequence 1:	NP_001096859.1	Gene:	fz3 / 31023	FlyBaseID:	FBgn0027343	Length:	646	Species:	Drosophila melanogaster
Sequence 2:	NP_113621.1	Gene:	MFRP / 83552	HGNCID:	18121	Length:	579	Species:	Homo sapiens

Alignment Length:	71	Identity:	23/71 - (32%)
Similarity:	34/71 - (47%)	Gaps:	4/71 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   150 CSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSFLNCDGLPQPEK 214
            |.:..|.|||..|.|.||| :...:..|:.:|:....:| ::....|...||  .||:.||:...
Human   512 CYQHFRRLLCGLLVPRCTP-LGSVLPPCRSVCQEAEHQC-QSGLALLGTPWP--FNCNRLPEAAD 572

  Fly   215 HELCMQ 220
            .|.|.|
Human   573 LEACAQ 578

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fz3	NP_001096859.1	RRM	<19..>122	CDD:223796
		RRM_1	22..83	CDD:278504
		CRD_FZ	<138..224	CDD:295308	23/71 (32%)
		Frizzled	291..584	CDD:279827
MFRP	NP_113621.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..143
		CUB	144..252	CDD:238001
		LDLa	260..294	CDD:238060
		CUB	301..411	CDD:238001
		LDLa	421..454	CDD:238060
		Fz	466..569	CDD:279700	19/60 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810