DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and FZD7

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_003498.1 Gene:FZD7 / 8324 HGNCID:4045 Length:574 Species:Homo sapiens


Alignment Length:525 Identity:140/525 - (26%)
Similarity:222/525 - (42%) Gaps:102/525 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DDEKGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELM 197
            :|...::.:..||::..||...||.|||...|:||. :.:.:..|:.|||..|..|     ..||
Human    77 EDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTV-LDQAIPPCRSLCERARQGC-----EALM 135

  Fly   198 E----LWPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTT--GSPGVEDHPQTYRFWKSG 256
            .    .||..|.|:..|.....|:|  :.|..:...|.|.|.||.  .:|.:.|.|.|       
Human   136 NKFGFQWPERLRCENFPVHGAGEIC--VGQNTSDGSGGPGGGPTAYPTAPYLPDLPFT------- 191

  Fly   257 ASP--TSDLAG-----VLCPQNFSGSPF------NPEECVPQCQ----RDAFHTSSQKKTSETLI 304
            |.|  .||..|     ..||:.....|:      ...:|...|:    ....:...:::....|.
Human   192 ALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLW 256

  Fly   305 LGL-SAVCFVLTLFALVTFWAEPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQA----RMHD 364
            :|: |.:|...|||.::|:..:..||.|||||::||..||.:.:|.::...:..::|    |..|
Human   257 VGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSD 321

  Fly   365 VELQWRLMRPGCLLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFHV 429
            .  .:|.:..| .....|...::...:..:.::.||:|.:|.::|::..||..||:|..|..||:
Human   322 D--GYRTVAQG-TKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHL 383

  Fly   430 LAWVPPLAPPIAALLLEKVRPSELTGMCYA--------PGFVELPALVLLLLGLYFTLRASRSLL 486
            .||..|....|..|.:.:|....|:|:||.        .|||..|..|.|.:|..|.|....||.
Human   384 AAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLF 448

  Fly   487 SLQQQLQPTLAHH------RFGQIRKRFVLFSLLYFAPTTAGVVAA------------------- 526
            .::     |:..|      :..::..|..:||:||..|.|  :|.|                   
Human   449 RIR-----TIMKHDGTKTEKLEKLMVRIGVFSVLYTVPAT--IVLACYFYEQAFREHWERTWLLQ 506

  Fly   527 LCERYADSVPSCSTPDDCLSPTPLSAWP----ALVRIFFQLVGGTLTGLWVWSRKTCESYR---N 584
            .|:.||...|....|       |:|  |    .:::....::.|..||.|:||.||.:|:|   :
Human   507 TCKSYAVPCPPGHFP-------PMS--PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYH 562

  Fly   585 RLGAS 589
            ||..|
Human   563 RLSHS 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 27/89 (30%)
Frizzled 291..584 CDD:279827 89/337 (26%)
FZD7NP_003498.1 CRD_FZ7 45..169 CDD:143575 29/99 (29%)
7tmF_FZD7 243..573 CDD:320374 92/344 (27%)
TM helix 1 253..277 CDD:320374 8/23 (35%)
TM helix 2 286..307 CDD:320374 8/20 (40%)
TM helix 3 337..359 CDD:320374 3/21 (14%)
TM helix 4 380..396 CDD:320374 6/15 (40%)
TM helix 5 418..441 CDD:320374 8/22 (36%)
TM helix 6 472..494 CDD:320374 8/23 (35%)
TM helix 7 523..548 CDD:320374 5/26 (19%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 552..557 2/4 (50%)
PDZ-binding 572..574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167933at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.