DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and SFRP5

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_003006.2 Gene:SFRP5 / 6425 HGNCID:10779 Length:317 Species:Homo sapiens


Alignment Length:109 Identity:37/109 - (33%)
Similarity:50/109 - (45%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL- 199
            |.|.:..:||:...|....:..|||...|:|   :.||:..|:.|||.||..|   ||  |||. 
Human    86 KQQASSWLPLLAKRCHSDTQVFLCSLFAPVC---LDRPIYPCRSLCEAVRAGC---AP--LMEAY 142

  Fly   200 ---WPSFLNCDGLPQPEKHELCMQIPQEVAVPGG--SPSGPPTT 238
               ||..|:|...|.  .::||      :||..|  ..:.||.|
Human   143 GFPWPEMLHCHKFPL--DNDLC------IAVQFGHLPATAPPVT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 30/89 (34%)
Frizzled 291..584 CDD:279827
SFRP5NP_003006.2 CRD_SFRP5 47..173 CDD:143553 34/102 (33%)
NTR_Sfrp1_like 178..303 CDD:239635 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.