DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fz3 and SFRP1

DIOPT Version :9

Sequence 1:	NP_001096859.1	Gene:	fz3 / 31023	FlyBaseID:	FBgn0027343	Length:	646	Species:	Drosophila melanogaster
Sequence 2:	NP_003003.3	Gene:	SFRP1 / 6422	HGNCID:	10776	Length:	314	Species:	Homo sapiens

Alignment Length:	110	Identity:	34/110 - (30%)
Similarity:	48/110 - (43%)	Gaps:	17/110 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   136 KGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL- 199
            |.|.:..|||:...|....:..|||...|:|   :.||:..|:.|||.||..|     ..:|:.
Human    91 KQQASSWVPLLNKNCHAGTQVFLCSLFAPVC---LDRPIYPCRWLCEAVRDSC-----EPVMQFF 147

  Fly   200 ---WPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSP 241
               ||..|.||..|:   .::|:.:....|.....|.|  ||..|
Human   148 GFYWPEMLKCDKFPE---GDVCIAMTPPNATEASKPQG--TTVCP 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fz3	NP_001096859.1	RRM	<19..>122	CDD:223796
		RRM_1	22..83	CDD:278504
		CRD_FZ	<138..224	CDD:295308	27/89 (30%)
		Frizzled	291..584	CDD:279827
SFRP1	NP_003003.3	CRD_SFRP1	52..175	CDD:143552	28/94 (30%)
SFRP1	NP_003003.3	NTR_Sfrp1_like	183..306	CDD:239635	3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141187
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.740