DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and sfrp2

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001070852.2 Gene:sfrp2 / 566878 ZFINID:ZDB-GENE-061013-293 Length:294 Species:Danio rerio


Alignment Length:193 Identity:48/193 - (24%)
Similarity:81/193 - (41%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL--- 199
            |.:...||::..|....:..|||...|:|..|:..|:..|:.|||:|:..|   ||  :|..   
Zfish    73 QASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLDEPIQPCRSLCESVKSGC---AP--VMAAFGF 132

  Fly   200 -WPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTSDL 263
             ||..|:|...|.  .::||  ||     |.|:.:..|.|     ::.|:.....|......:::
Zfish   133 PWPDMLDCRRFPL--DNDLC--IP-----PAGADALVPVT-----KEVPRVCDACKEKPENDNEI 183

  Fly   264 AGVLCPQNFS-------GSPFNPE-ECVPQCQRDAFHTSSQ-------KKTSETLILGLSAVC 311
            ...||..:|:       .|..|.: :.:|:.:....:.::.       :||...|..||..||
Zfish   184 VDSLCKNDFALKIKVKEISYMNGDTKIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 29/89 (33%)
Frizzled 291..584 CDD:279827 7/28 (25%)
sfrp2NP_001070852.2 CRD_SFRP2 34..161 CDD:143555 31/101 (31%)
NTR_Sfrp1_like 167..294 CDD:239635 15/80 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.