DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and col18a1a

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_021334395.1 Gene:col18a1a / 564123 ZFINID:ZDB-GENE-030516-3 Length:1645 Species:Danio rerio


Alignment Length:158 Identity:37/158 - (23%)
Similarity:51/158 - (32%) Gaps:47/158 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECM----ENAPPELMELWPSFLN 205
            |:.|||.....:..|..|.|.|...  ..:..|:..||.::..|.    |...|         :.
Zfish   249 LLRSGCHHSLEWFFCLLLTPRCGHS--GSLLPCRSSCEVLQDSCWTLLDEGRLP---------VE 302

  Fly   206 CDGLPQPEKHE--LCMQIPQEVAVPGGS----PSGPPTTG---------SPGVEDHPQT------ 249
            |..||: |||:  .|:.:.......|.|    ...||..|         |||....|.:      
Zfish   303 CKSLPE-EKHDGYRCLSVSNLKEESGVSLLQLIGDPPPNGVSKVFDQANSPGYVFGPSSNVGQSA 366

  Fly   250 --------YRFWK--SGASPTSDLAGVL 267
                    ||.:.  ....|||...||:
Zfish   367 AAHLPNPFYRDFSLIFNIKPTSSKPGVI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 21/84 (25%)
Frizzled 291..584 CDD:279827
col18a1aXP_021334395.1 CRD_Collagen_XVIII 203..340 CDD:143564 25/102 (25%)
LamG 327..516 CDD:328935 16/68 (24%)
Collagen 816..860 CDD:189968
Collagen <937..980 CDD:189968
Collagen 959..1055 CDD:189968
Endostatin 1471..1639 CDD:310825
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.