DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and sfrp5

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001004846.1 Gene:sfrp5 / 448129 XenbaseID:XB-GENE-482920 Length:315 Species:Xenopus tropicalis


Alignment Length:173 Identity:46/173 - (26%)
Similarity:65/173 - (37%) Gaps:57/173 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MIAWSDADDVSIVERNEDEDDD-----------DYKSD------------------------DEK 136
            ::.||.|::........|...:           |..||                        :.|
 Frog    18 LVLWSSAEEYDYYSWQSDNFQNGRFYTKQSQCIDIPSDLHLCHNVGYKKMRLPNLLDHETMPEVK 82

  Fly   137 GQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL-- 199
            .|.:..|||:...|.|..:..|||...|:|   :.||:..|:.|||.||..|   ||  :||.  
 Frog    83 QQASSWVPLLAKRCHRDTQLFLCSLFAPIC---LERPIYPCRSLCEVVRDSC---AP--VMESYG 139

  Fly   200 --WPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSP--SGPPTT 238
              ||..|||:..|.  .::||      :.|..||.  :.||.|
 Frog   140 FPWPEMLNCNKFPL--DNDLC------ITVQFGSKQVTQPPVT 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796 3/14 (21%)
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 32/89 (36%)
Frizzled 291..584 CDD:279827
sfrp5NP_001004846.1 CRD_SFRP5 43..169 CDD:143553 39/141 (28%)
NTR_Sfrp1_like 174..299 CDD:239635 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.