DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and szl

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_858049.1 Gene:szl / 353294 ZFINID:ZDB-GENE-030530-1 Length:282 Species:Danio rerio


Alignment Length:211 Identity:50/211 - (23%)
Similarity:78/211 - (36%) Gaps:53/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVSNASFRSLKANC----------CVYAPPKKKRMIAWSDADDVSIVER-------NEDEDDDDY 130
            |.|...|.||.|:.          ||..||:      .|...||...|.       :...::...
Zfish     3 LFSLLLFFSLAAHTGAFDLGQTTRCVPIPPQ------MSVCQDVPYSEMRLPNLLGHGSLEEAAP 61

  Fly   131 KSDDEKGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPE 195
            :|||       |..|:.:||..:||..:||.:.|:|   :.|.:..|:.:|..|:..|    .|.
Zfish    62 RSDD-------LRTLLHTGCHPQARAFVCSLIAPVC---LDRFIQPCRSVCLAVKESC----SPV 112

  Fly   196 LM---ELWPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGA 257
            |.   ..||..|||:..  ||:.:....:|:.::........|.....|.|::.|.         
Zfish   113 LACHGHSWPESLNCERF--PEQDDCLTPLPKHISAFSKEFPQPACQSCPSVQESPS--------- 166

  Fly   258 SPTSDLAGVLCPQNFS 273
              ...|...||..:|:
Zfish   167 --LKTLLDSLCLNDFA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796 14/55 (25%)
RRM_1 22..83 CDD:278504 50/211 (24%)
CRD_FZ <138..224 CDD:295308 25/88 (28%)
Frizzled 291..584 CDD:279827
szlNP_858049.1 CRD_FZ 19..158 CDD:295308 37/160 (23%)
NTR_Sfrp1_like 152..282 CDD:239635 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.