DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Mfrp

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001101607.1 Gene:Mfrp / 315597 RGDID:1307477 Length:590 Species:Rattus norvegicus


Alignment Length:72 Identity:22/72 - (30%)
Similarity:33/72 - (45%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 CSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL-WPSFLNCDGLPQPE 213
            |.:..|..||..|.|.|| .:...:..|:.:|:....:|..:.  .|:.: ||  .||:.||.|.
  Rat   523 CYQTFRRFLCGLLEPRCT-SLGTILPPCRSVCQEAEQQCQSSL--ALLGIPWP--FNCNRLPVPA 582

  Fly   214 KHELCMQ 220
            ..|.|.|
  Rat   583 SLEACSQ 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 22/72 (31%)
Frizzled 291..584 CDD:279827
MfrpNP_001101607.1 CUB 150..258 CDD:238001
LDLa 266..300 CDD:238060
CUB 307..419 CDD:238001
Fz 477..579 CDD:279700 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.