powered by:
Protein Alignment fz3 and Mfrp
DIOPT Version :9
Sequence 1: | NP_001096859.1 |
Gene: | fz3 / 31023 |
FlyBaseID: | FBgn0027343 |
Length: | 646 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101607.1 |
Gene: | Mfrp / 315597 |
RGDID: | 1307477 |
Length: | 590 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 33/72 - (45%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 CSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL-WPSFLNCDGLPQPE 213
|.:..|..||..|.|.|| .:...:..|:.:|:....:|..:. .|:.: || .||:.||.|.
Rat 523 CYQTFRRFLCGLLEPRCT-SLGTILPPCRSVCQEAEQQCQSSL--ALLGIPWP--FNCNRLPVPA 582
Fly 214 KHELCMQ 220
..|.|.|
Rat 583 SLEACSQ 589
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3577 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.