DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Sfrp2

DIOPT Version :10

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001094170.1 Gene:Sfrp2 / 310552 RGDID:735163 Length:295 Species:Rattus norvegicus


Alignment Length:142 Identity:39/142 - (27%)
Similarity:57/142 - (40%) Gaps:27/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL--- 199
            |....:||:...|....:..|||...|:|..|:...:..|..||..|:..|   ||  :|..   
  Rat    75 QAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRC---AP--VMSAFGF 134

  Fly   200 -WPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSG--PPTTGSPGVEDHPQTYRFWKSGASPTS 261
             ||..|.||..||  .::||        :|..|...  |||      |:.|:.....|:.....:
  Rat   135 PWPDMLECDRFPQ--DNDLC--------IPLASSDHLLPPT------EEAPKVCEACKTKNEDDN 183

  Fly   262 DLAGVLCPQNFS 273
            |:...||..:|:
  Rat   184 DIMETLCKNDFA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM_1 22..83 CDD:425453
CRD_FZ <138..224 CDD:470581 27/89 (30%)
7tmF_FZD3_insect 290..587 CDD:320159
TM helix 1 299..324 CDD:320159
TM helix 2 333..354 CDD:320159
TM helix 3 383..409 CDD:320159
TM helix 4 426..442 CDD:320159
TM helix 5 469..493 CDD:320159
TM helix 6 513..540 CDD:320159
TM helix 7 548..573 CDD:320159
Sfrp2NP_001094170.1 CRD_SFRP2 36..163 CDD:143555 29/102 (28%)
NTR_Sfrp1_like 169..295 CDD:239635 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.