DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Mfrp

DIOPT Version :10

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_667337.1 Gene:Mfrp / 259172 MGIID:2385957 Length:584 Species:Mus musculus


Alignment Length:71 Identity:20/71 - (28%)
Similarity:32/71 - (45%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 CSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSFLNCDGLPQPEK 214
            |.:..:..||..|.|.|| .:...:..|:.:|:....:| :::...|...||  .||:.||....
Mouse   517 CYQTFQRFLCGLLVPRCT-SLGTILPPCRSVCQAAEQQC-QSSLALLGTPWP--FNCNRLPVAAS 577

  Fly   215 HELCMQ 220
            .|.|.|
Mouse   578 LEACSQ 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM_1 22..83 CDD:425453
CRD_FZ <138..224 CDD:470581 20/71 (28%)
7tmF_FZD3_insect 290..587 CDD:320159
TM helix 1 299..324 CDD:320159
TM helix 2 333..354 CDD:320159
TM helix 3 383..409 CDD:320159
TM helix 4 426..442 CDD:320159
TM helix 5 469..493 CDD:320159
TM helix 6 513..540 CDD:320159
TM helix 7 548..573 CDD:320159
MfrpNP_667337.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..140
CUB 150..258 CDD:238001
LDLa 266..300 CDD:238060
CUB 307..419 CDD:238001
CRD_FZ 470..584 CDD:143549 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.