DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Cpz

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_694747.2 Gene:Cpz / 242939 MGIID:88487 Length:654 Species:Mus musculus


Alignment Length:128 Identity:40/128 - (31%)
Similarity:55/128 - (42%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LIESGCSRRARFLLCSSLFPLCT-PDVPRPVAACKLLCETVRGECMENAPPELMELWPSFLNCDG 208
            |:|..|:...|.|.||.|.|.|. ....||   |:.:||.:|..| :.|...:...||.||:|..
Mouse    93 LLEGQCNPDLRLLGCSVLAPRCEGGHTQRP---CRHVCEGLREAC-QPAFDAIDMAWPYFLDCAQ 153

  Fly   209 LPQPEK-------HELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTSDLA 264
            ...||:       .||..::..|.|:|.|.   |||........:.|..|..|..|:..|.:|
Mouse   154 YFAPEEEGCYDPLEELRGELDVEEALPSGL---PPTFIRFAHHSYAQMVRVLKRTAARCSQVA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 27/86 (31%)
Frizzled 291..584 CDD:279827
CpzNP_694747.2 CRD_FZ 45..172 CDD:295308 27/82 (33%)
M14_CPZ 192..506 CDD:199849 6/22 (27%)
Peptidase_M14NE-CP-C_like 510..586 CDD:200604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 596..630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.