DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and sfrp5

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_571933.1 Gene:sfrp5 / 117510 ZFINID:ZDB-GENE-011108-2 Length:310 Species:Danio rerio


Alignment Length:101 Identity:35/101 - (34%)
Similarity:49/101 - (48%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DYKSDDE-KGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENA 192
            |:::..| |.|....|||:...|....:..|||...|:|   :.||:..|:.|||.||..|   |
Zfish    77 DHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVC---LDRPIYPCRSLCEAVRDSC---A 135

  Fly   193 PPELMEL----WPSFLNCDGLPQPEKHELCMQIPQE 224
            |  :||.    ||..|.|:..  |..::||  ||.:
Zfish   136 P--VMETYGFPWPEMLQCEKF--PIDNDLC--IPMQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 32/89 (36%)
Frizzled 291..584 CDD:279827
sfrp5NP_571933.1 CRD_SFRP5 46..172 CDD:143553 35/101 (35%)
NTR_Sfrp1_like 177..302 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.