DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and FZD10

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_009128.1 Gene:FZD10 / 11211 HGNCID:4039 Length:581 Species:Homo sapiens


Alignment Length:550 Identity:151/550 - (27%)
Similarity:238/550 - (43%) Gaps:123/550 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELME---- 198
            |:.:..||:|.||....||.|||...|:||..|..|:.||:::||..|.:|   :|  :||    
Human    67 QLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKC---SP--IMEQFNF 126

  Fly   199 LWPSFLNCDGLP-QPEKHELCMQIPQEVAVPGGSPSGPPTTGS------------PGVEDHPQTY 250
            .||..|:|..|| :.:.:.|||:.|       .:.|..||.||            ...::||   
Human   127 KWPDSLDCRKLPNKNDPNYLCMEAP-------NNGSDEPTRGSGLFPPLFRPQRPHSAQEHP--- 181

  Fly   251 RFWKSGASPTSDLAGVLCPQNFSGSPFNP---------EECVPQCQR--DAFHTSSQKKTSETLI 304
              .|.|...             .|...||         ..|.|.|..  |.:.:...|:.:...:
Human   182 --LKDGGPG-------------RGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWL 231

  Fly   305 LGLSAVCFVLTLFALVTFWAEPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQARMHDVE--- 366
            ...:.:||..:.|.::||..:|.||.|||||::||.:||.::||.||.|:....::...|.:   
Human   232 AIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQ 296

  Fly   367 ---LQWRLMRPGCLLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFH 428
               :|..|...||.|.      ::...|..:.::.||::..|.::|::.|||..||:|..|..||
Human   297 LYVIQEGLESTGCTLV------FLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFH 355

  Fly   429 VLAWVPPLAPPIAALLLEKVRPSELTGMCYA--------PGFVELPALVLLLLGLYFTLRASRSL 485
            :.||..|....|..|::.:|...||||:||.        .|||.:|....|::|..|.|....:|
Human   356 LAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL 420

  Fly   486 LSLQQQLQPTLAH-HRFGQIRKRFVLFSLLYFAPTTAGVVAALCER-------YADSVPSCSTPD 542
            ..:::.::....: .:..::..|..|||:||..|.|..:.....||       ...:...|...:
Human   421 FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNN 485

  Fly   543 -----DCLSPTPLSAWPA----LVRIFFQLVGGTLTGLWVWSRKTCESYR----NRLGASGTPTS 594
                 |||....:   ||    :|:||..||.|..:|:|:|:.||.:|::    .||        
Human   486 QTKTLDCLMAASI---PAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRL-------- 539

  Fly   595 SLMNQSKAAGALPKKHLYTSGKSMLPTGGI 624
                         ||.......|::.:|||
Human   540 -------------KKKSRRKPASVITSGGI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 35/90 (39%)
Frizzled 291..584 CDD:279827 92/327 (28%)
FZD10NP_009128.1 CRD_FZ10 30..156 CDD:143571 35/100 (35%)
7tmF_FZD10 217..535 CDD:320165 92/326 (28%)
TM helix 1 226..251 CDD:320165 5/24 (21%)
TM helix 2 260..281 CDD:320165 11/20 (55%)
TM helix 3 310..336 CDD:320165 5/31 (16%)
TM helix 4 353..369 CDD:320165 6/15 (40%)
TM helix 5 391..420 CDD:320165 8/28 (29%)
TM helix 6 440..467 CDD:320165 9/26 (35%)
TM helix 7 497..522 CDD:320165 9/27 (33%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 526..531 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..581
PDZ-binding 579..581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509772at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.