DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fz3 and CORIN

DIOPT Version :9

Sequence 1:	NP_001096859.1	Gene:	fz3 / 31023	FlyBaseID:	FBgn0027343	Length:	646	Species:	Drosophila melanogaster
Sequence 2:	NP_006578.2	Gene:	CORIN / 10699	HGNCID:	19012	Length:	1042	Species:	Homo sapiens

Alignment Length:	86	Identity:	24/86 - (27%)
Similarity:	36/86 - (41%)	Gaps:	14/86 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   140 AKLVP-LIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSF 203
            :.|.| |:::.|.:...|..|:.|.|.|..:....:..|:.|||..:..|            .|.
Human   491 SSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERC------------ESV 543

  Fly   204 LNCDGLPQPEKHELCMQIPQE 224
            |...||..||..: |.|.|:|
Human   544 LGIVGLQWPEDTD-CSQFPEE 563

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fz3	NP_001096859.1	RRM	<19..>122	CDD:223796
		RRM_1	22..83	CDD:278504
		CRD_FZ	<138..224	CDD:295308	23/84 (27%)
		Frizzled	291..584	CDD:279827
CORIN	NP_006578.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		DDNN motif	26..29
		CRD_corin_1	135..263	CDD:143554
		LDLa	269..304	CDD:238060
		LDLa	306..340	CDD:238060
		Ldl_recept_a	347..377	CDD:278486
		LDLa	387..414	CDD:238060
		CRD_corin_2	454..575	CDD:143579	24/86 (28%)
		LDLa	580..614	CDD:238060
		LDLa	655..689	CDD:238060
		SR	690..786	CDD:214555
		Tryp_SPc	801..1030	CDD:214473
		Tryp_SPc	802..1033	CDD:238113
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810