DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and mfrp

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_009289590.1 Gene:mfrp / 101885305 ZFINID:ZDB-GENE-160728-150 Length:572 Species:Danio rerio


Alignment Length:86 Identity:25/86 - (29%)
Similarity:38/86 - (44%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPP-ELMEL-WPSFLNCD 207
            |::..|....|.|:|....|.|:|. ...:..|:.:|.|...:|   :|. .|..| ||  .|| 
Zfish   500 LVDLPCFESFRQLVCGMFLPRCSPQ-SGVLQLCQSVCSTAELQC---SPALSLFSLNWP--FNC- 557

  Fly   208 GLPQPEKHELCMQIPQEVAVP 228
             |..|:.|:     |.|.::|
Zfish   558 -LLLPDSHD-----PMECSLP 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 23/80 (29%)
Frizzled 291..584 CDD:279827
mfrpXP_009289590.1 CUB 138..248 CDD:238001
LDLa 256..290 CDD:238060
CUB 297..405 CDD:238001
LDLa 413..447 CDD:238060
Fz 459..563 CDD:279700 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.