DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and sfrp2l

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001373251.1 Gene:sfrp2l / 100538205 ZFINID:ZDB-GENE-061122-2 Length:250 Species:Danio rerio


Alignment Length:112 Identity:45/112 - (40%)
Similarity:52/112 - (46%) Gaps:26/112 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMEL--- 199
            |.|..||||...|.|..|..|||...|:|.|:||.||:.|:.||..||..|   ||  :|..   
Zfish    29 QSAAWVPLIGKRCHRDTRRFLCSLFAPVCLPEVPTPVSPCRNLCVAVRDAC---AP--VMSAFGF 88

  Fly   200 -WPSFLNC----DGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSP 241
             ||...||    ||      .|||  ||.|:     .|...|||.:|
Zfish    89 PWPEMFNCSRFTDG------PELC--IPGEI-----DPLRAPTTLAP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 39/93 (42%)
Frizzled 291..584 CDD:279827
sfrp2lNP_001373251.1 CRD_FZ 1..108 CDD:413323 37/91 (41%)
NTR_like 125..250 CDD:413349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.