DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz3 and Fzd7

DIOPT Version :9

Sequence 1:NP_001096859.1 Gene:fz3 / 31023 FlyBaseID:FBgn0027343 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001258114.1 Gene:Fzd7 / 100360552 RGDID:2321905 Length:572 Species:Rattus norvegicus


Alignment Length:521 Identity:141/521 - (27%)
Similarity:223/521 - (42%) Gaps:96/521 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DDEKGQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELM 197
            :|...::.:..||::..||...||.|||...|:||. :.:.:..|:.|||..|..|     ..||
  Rat    77 EDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTV-LDQAIPPCRSLCERARQGC-----EALM 135

  Fly   198 E----LWPSFLNCDGLPQPEKHELCMQIPQEVA----VPGGSPSGPPTTGSPGVEDHPQTYRFWK 254
            .    .||..|.|:..|.....|:|  :.|..:    ..||||:..||  :|.:.|.|.|     
  Rat   136 NKFGFQWPERLRCENFPVHGAGEIC--VGQNTSDGSGGAGGSPTAYPT--APYLPDPPFT----- 191

  Fly   255 SGASPTSDLAG-----VLCPQNFSGSPF------NPEECVPQCQ----RDAFHTSSQKKTSETLI 304
              |...||..|     ..||:.....|:      ...:|...|:    ....:...:::....|.
  Rat   192 --AMSPSDGRGRWSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLW 254

  Fly   305 LGL-SAVCFVLTLFALVTFWAEPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQA----RMHD 364
            :|: |.:|...|||.::|:..:..||.|||||::||..||.:.:|.::...:..::|    |..|
  Rat   255 VGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSD 319

  Fly   365 VELQWRLMRPGCLLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFHV 429
            .  .:|.:..| .....|...::...:..:.::.||:|.:|.::|::..||..||:|..|..||:
  Rat   320 D--GYRTVAQG-TKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHL 381

  Fly   430 LAWVPPLAPPIAALLLEKVRPSELTGMCYA--------PGFVELPALVLLLLGLYFTLRASRSLL 486
            .||..|....|..|.:.:|....|:|:||.        .|||..|..|.|.:|..|.|....||.
  Rat   382 AAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLF 446

  Fly   487 SLQQQLQPTLAHH------RFGQIRKRFVLFSLLYFAPTTAGVVAA------------------- 526
            .::     |:..|      :..::..|..:||:||..|.|  :|.|                   
  Rat   447 RIR-----TIMKHDGTKTEKLEKLMVRIGVFSVLYTVPAT--IVLACYFYEQAFREHWERTWLLQ 504

  Fly   527 LCERYADSVPSCSTPDDCLSPTPLSAWPALVRIFFQLVGGTLTGLWVWSRKTCESYR---NRLGA 588
            .|:.||  || |  |....||........:::....::.|..||.|:||.||.:|:|   :||..
  Rat   505 TCKSYA--VP-C--PPGHFSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSH 564

  Fly   589 S 589
            |
  Rat   565 S 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz3NP_001096859.1 RRM <19..>122 CDD:223796
RRM_1 22..83 CDD:278504
CRD_FZ <138..224 CDD:295308 27/89 (30%)
Frizzled 291..584 CDD:279827 90/333 (27%)
Fzd7NP_001258114.1 CRD_FZ7 45..169 CDD:143575 29/99 (29%)
7tmF_FZD7 241..571 CDD:320374 93/340 (27%)
TM helix 1 251..275 CDD:320374 8/23 (35%)
TM helix 2 284..305 CDD:320374 8/20 (40%)
TM helix 3 335..357 CDD:320374 3/21 (14%)
TM helix 4 378..394 CDD:320374 6/15 (40%)
TM helix 5 416..439 CDD:320374 8/22 (36%)
TM helix 6 470..492 CDD:320374 8/23 (35%)
TM helix 7 521..546 CDD:320374 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167933at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.