powered by:
Protein Alignment CG5273 and F35A5.5
DIOPT Version :9
Sequence 1: | NP_569857.1 |
Gene: | CG5273 / 31021 |
FlyBaseID: | FBgn0040382 |
Length: | 469 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508658.2 |
Gene: | F35A5.5 / 185250 |
WormBaseID: | WBGene00018027 |
Length: | 211 |
Species: | Caenorhabditis elegans |
Alignment Length: | 139 |
Identity: | 39/139 - (28%) |
Similarity: | 43/139 - (30%) |
Gaps: | 62/139 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 GLGFGTGLLAGGLGGALLGHALTPSGGSSSSQ--------PVAAAPAAGQDRIIIINNGVPVNAS 296
|.|||.| ..||.|| |......|...|:. |....|.. :|:
Worm 49 GFGFGGG-FGGGFGG---GFGFGGGGCCVSTMICCQMPIPPPMPPPIP-----------IPI--- 95
Fly 297 DGTTVINAAGVAAAPGAVPAAPVPSSNTTQDAQQPA-VPMAPMPFNPETSNMTAPDPAAPPPPGG 360
.||..|| |||| ||. ||| ||| |..|.|...|.|
Worm 96 ------------PAPVPVP-APVP---------QPVPVPM-PMP-------MPMPMPMPVPVP-- 128
Fly 361 IICVPTKVN 369
||.:.|
Worm 129 ---VPVQSN 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5273 | NP_569857.1 |
DUF4813 |
165..385 |
CDD:292690 |
39/139 (28%) |
F35A5.5 | NP_508658.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CXNA |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.