DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5273 and F35A5.5

DIOPT Version :9

Sequence 1:NP_569857.1 Gene:CG5273 / 31021 FlyBaseID:FBgn0040382 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_508658.2 Gene:F35A5.5 / 185250 WormBaseID:WBGene00018027 Length:211 Species:Caenorhabditis elegans


Alignment Length:139 Identity:39/139 - (28%)
Similarity:43/139 - (30%) Gaps:62/139 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 GLGFGTGLLAGGLGGALLGHALTPSGGSSSSQ--------PVAAAPAAGQDRIIIINNGVPVNAS 296
            |.|||.| ..||.||   |......|...|:.        |....|..           :|:   
 Worm    49 GFGFGGG-FGGGFGG---GFGFGGGGCCVSTMICCQMPIPPPMPPPIP-----------IPI--- 95

  Fly   297 DGTTVINAAGVAAAPGAVPAAPVPSSNTTQDAQQPA-VPMAPMPFNPETSNMTAPDPAAPPPPGG 360
                        .||..|| ||||         ||. ||| |||       |..|.|...|.|  
 Worm    96 ------------PAPVPVP-APVP---------QPVPVPM-PMP-------MPMPMPMPVPVP-- 128

  Fly   361 IICVPTKVN 369
               ||.:.|
 Worm   129 ---VPVQSN 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5273NP_569857.1 DUF4813 165..385 CDD:292690 39/139 (28%)
F35A5.5NP_508658.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CXNA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.