DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5273 and CG43153

DIOPT Version :9

Sequence 1:NP_569857.1 Gene:CG5273 / 31021 FlyBaseID:FBgn0040382 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001245989.1 Gene:CG43153 / 12798157 FlyBaseID:FBgn0262683 Length:190 Species:Drosophila melanogaster


Alignment Length:153 Identity:46/153 - (30%)
Similarity:71/153 - (46%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALFALLLTHGGDNVVDARRNQGNQRKTSSSSSS--SNYGHVTQPSYNTNGHAAGNSHADVAKLSY 80
            ::..:::.....|:.......|::..:|||.||  |:||    .||.:|   .|:::...::.||
  Fly    10 SILVMVIILQAQNIATGTPRGGSRSSSSSSRSSPRSSYG----SSYGSN---YGSTYGSGSRHSY 67

  Fly    81 --PNYNSQPNRPMAAGSSGSPGSAP--QPGWNVPQGPPPAYSASNPAGGARPNMHEPPPAYHAPN 141
              |:|:          |.....|.|  ..|.|:|:||||||||.:..|||..|:.|.||||..|.
  Fly    68 SPPSYS----------SLSKTFSLPTFDLGHNLPKGPPPAYSAHDTVGGAPTNIRERPPAYKPPR 122

  Fly   142 YGAAPPNYGAATGSNVHQPQYSG 164
                     ....|:::..||.|
  Fly   123 ---------KQISSSLYHNQYQG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5273NP_569857.1 DUF4813 165..385 CDD:292690 46/153 (30%)
CG43153NP_001245989.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014362
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR38572
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.