DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and SLC25A21

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_011535589.1 Gene:SLC25A21 / 89874 HGNCID:14411 Length:303 Species:Homo sapiens


Alignment Length:291 Identity:168/291 - (57%)
Similarity:213/291 - (73%) Gaps:13/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAGGSAGFLEVCIMQPLDVVKTRIQIQ--ATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWK 81
            |..|....:|:|:|.||||||||.|||  ||. ||:       |..:.|.|..:::.||:..::|
Human    22 LPSGLLSLVEICLMHPLDVVKTRFQIQRCATD-PNS-------YKSLVDSFRMIFQMEGLFGFYK 78

  Fly    82 GIMPPILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQ 146
            ||:|||||||||||:||..|||.|.|..:.|.:|. |||::|||.:|..|||.|||||||||..|
Human    79 GILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPA-LTFAIAGLGSGLTEAIVVNPFEVVKVGLQ 142

  Fly   147 ADRQ--KKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVVPEYKES 209
            |:|.  .:..||...|:.||:::|.|..|||||:|||:||:|||||||||||::|||::|..|:.
Human   143 ANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDP 207

  Fly   210 HLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGFRALYK 274
            .|||.||..||.|:||:|..:|||||||||||||||||||:||||....:|..||:|||..||||
Human   208 ILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYK 272

  Fly   275 GLVPKIMRLGPGGAILLLVFEYSYDYLLHNY 305
            ||:|||||||||||::|||:||:|.:|..|:
Human   273 GLLPKIMRLGPGGAVMLLVYEYTYSWLQENW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 46/94 (49%)
PTZ00169 19..301 CDD:240302 166/285 (58%)
Mito_carr 122..207 CDD:278578 51/86 (59%)
Mito_carr 209..305 CDD:278578 64/95 (67%)
SLC25A21XP_011535589.1 Mito_carr 19..109 CDD:278578 46/94 (49%)
PTZ00168 22..287 CDD:185494 159/273 (58%)
Mito_carr 109..201 CDD:278578 55/92 (60%)
Mito_carr 209..302 CDD:278578 64/92 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159650
Domainoid 1 1.000 135 1.000 Domainoid score I5008
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6988
Inparanoid 1 1.050 338 1.000 Inparanoid score I2384
Isobase 1 0.950 - 0.959148 Normalized mean entropy S891
OMA 1 1.010 - - QHG53612
OrthoDB 1 1.010 - - D1236425at2759
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 1 1.000 - - oto90921
orthoMCL 1 0.900 - - OOG6_101369
Panther 1 1.100 - - LDO PTHR46356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R860
SonicParanoid 1 1.000 - - X2643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.