DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and SAMC2

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_564436.4 Gene:SAMC2 / 840304 AraportID:AT1G34065 Length:345 Species:Arabidopsis thaliana


Alignment Length:296 Identity:78/296 - (26%)
Similarity:131/296 - (44%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQHDISHAKRAAFQ-VLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCF 67
            :|.|..|..|..:: ::.||.||.:....:.|:|.:|||||:       |...|::.:.|::   
plant    67 KQDDPCHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRIQV-------ARDGGKIIWKGLY--- 121

  Fly    68 AKMYRHEGISSYWKGIMPPILAETPKRAIKFLVFEQTK-PLFQFGSPTPTPLTFSLAGLTAGTLE 131
                  .|:.....|::       |..|:.|.|:|.|| .|.:......:.:....||...|.:.
plant   122 ------SGLGGNLVGVL-------PASALFFGVYEPTKQKLLKVLPDNLSAVAHLAAGALGGAVS 173

  Fly   132 AIAVNPFEVVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFY 196
            :|...|.||||...|..   :.:|.....:.||.::  ||.|:..|..:.:.|:..|:.:.|..|
plant   174 SIVRVPTEVVKQRMQTG---QFVSAPDAVRLIIAKE--GFGGMYAGYGSFLLRDLPFDALQFCVY 233

  Fly   197 HSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSR--IQGPQPVPGQIKYRGTLSS 259
            ..::..........|.......||..||.:...:..|.||.|:|  :||     ...:|:|....
plant   234 EQLRIGYKLAARRDLNDPENAMIGAFAGAVTGVLTTPLDVIKTRLMVQG-----SGTQYKGVSDC 293

  Fly   260 MGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            :..:.||||..||:||:.|:::.:|.||:|...|.|
plant   294 IKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 24/94 (26%)
PTZ00169 19..301 CDD:240302 74/280 (26%)
Mito_carr 122..207 CDD:278578 21/84 (25%)
Mito_carr 209..305 CDD:278578 29/89 (33%)
SAMC2NP_564436.4 Mito_carr 78..153 CDD:278578 24/97 (25%)
PTZ00168 79..328 CDD:185494 72/281 (26%)
Mito_carr 155..237 CDD:278578 21/86 (24%)
Mito_carr 247..339 CDD:278578 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.