DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and mSFC1

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_195754.1 Gene:mSFC1 / 831479 AraportID:AT5G01340 Length:309 Species:Arabidopsis thaliana


Alignment Length:320 Identity:100/320 - (31%)
Similarity:148/320 - (46%) Gaps:66/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWK 81
            :.::|...|.:|.|.:||:||:|||:|:....|          |.|:..|.:|:.|.||:.:.||
plant    16 KAVSGSLGGVVEACCLQPIDVIKTRLQLDRVGA----------YKGIAHCGSKVVRTEGVRALWK 70

  Fly    82 GIMPPILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFS-------------LAGLTAGTLEAI 133
            |:.|            |......|...:.||.......|.             |:|..||.|||:
plant    71 GLTP------------FATHLTLKYTLRMGSNAMFQTAFKDSETGKVSNRGRFLSGFGAGVLEAL 123

  Fly   134 A-VNPFEVVKVAQQADRQKKMLS--------TFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFN 189
            | |.||||||:..|   |:|.||        ....|:.|::::.:  .||..|...|:.|||...
plant   124 AIVTPFEVVKIRLQ---QQKGLSPELFKYKGPIHCARTIVREESI--LGLWSGAAPTVMRNGTNQ 183

  Fly   190 MVYFGFYHSVKNVVP-------EYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQG-PQP 246
            .|.|    :.||...       |.....|:..:.:..||||||...|...||||.|:|:.. .:.
plant   184 AVMF----TAKNAFDILLWNKHEGDGKILQPWQSMISGFLAGTAGPFCTGPFDVVKTRLMAQSRD 244

  Fly   247 VPGQIKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE-----YSYDYL 301
            ..|.|:|:|.:.::..:|.|||..||::||:|::||:.||.||:..|.:     |...||
plant   245 SEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPPGQAIMWAVADQVTGLYEMRYL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 26/93 (28%)
PTZ00169 19..301 CDD:240302 98/316 (31%)
Mito_carr 122..207 CDD:278578 34/100 (34%)
Mito_carr 209..305 CDD:278578 37/99 (37%)
mSFC1NP_195754.1 Mito_carr 9..>74 CDD:278578 23/67 (34%)
Mito_carr 103..200 CDD:278578 33/105 (31%)
Mito_carr 210..295 CDD:278578 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3575
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53612
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2643
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.