DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG1907

DIOPT Version :10

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:138 Identity:29/138 - (21%)
Similarity:43/138 - (31%) Gaps:50/138 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLRVTTEAPVEE---LLDLLLDLKNN---LIVLAASGLLVAV--------------------- 38
            |.|:..:||...||   |::.:|...||   ..|||...::|.|                     
  Fly   304 MEKMNSSTEQKSEECISLVERILQKTNNPKIAAVLALDLIMVGVDTTSVAATSTIYQLSQNPDKQ 368

  Fly    39 --LF---------------LCMVVAYPFYLRSFKNNLVFY------GKSTLLPIITFEYRTIKYN 80
              ||               :.|:...|:.....|..|..|      |:|.....:...|...|..
  Fly   369 EILFNEIKRSMPSPDTKFTISMLETMPYLRACIKETLRMYPVVIGNGRSLQTDAVIGGYHIPKGT 433

  Fly    81 YFVFFVLV 88
            :.:|..||
  Fly   434 HVIFPHLV 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:395101 22/118 (19%)
Mito_carr 122..207 CDD:395101
Mito_carr 209..305 CDD:395101
CG1907NP_651703.1 Mito_carr 16..109 CDD:395101
Mito_carr 118..207 CDD:395101
Mito_carr 219..307 CDD:395101 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.