DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and mfrn

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:113/291 - (38%) Gaps:37/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIM 84
            ||..||.||..:|.|||.||||:|..:.|..|.         .:......|...||:....:|..
  Fly    20 AGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNM---------NIVSTLRTMITREGLLRPIRGAS 75

  Fly    85 PPILAETPKRAIKFLVFEQTKPL-FQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQAD 148
            ..:|...|..::.|..:|.||.| .:|.|  ...|.:.::|..|..:.....:|.:|:|...|. 
  Fly    76 AVVLGAGPAHSLYFAAYEMTKELTAKFTS--VRNLNYVISGAVATLIHDAISSPTDVIKQRMQM- 137

  Fly   149 RQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVY-------FGFYHSVKNVVPEY 206
            ......|..:..:.|.:::|.      |......|...|.|:.|       :.|:.:..|:..:|
  Fly   138 YNSPYTSVVSCVRDIYKREGF------KAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKY 196

  Fly   207 KES-HLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGFR 270
            ... |:      ..|..||..|..|..|.||.|:.:...:  .|..  ||.:.:...:|...|..
  Fly   197 NPPVHM------AAGAAAGACAAAVTTPLDVIKTLLNTQE--TGLT--RGMIEASRKIYHMAGPL 251

  Fly   271 ALYKGLVPKIMRLGPGGAILLLVFEYSYDYL 301
            ..::|...:::...|..||....:|:...||
  Fly   252 GFFRGTTARVLYSMPATAICWSTYEFFKFYL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 29/92 (32%)
PTZ00169 19..301 CDD:240302 68/289 (24%)
Mito_carr 122..207 CDD:278578 16/91 (18%)
Mito_carr 209..305 CDD:278578 22/94 (23%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 27/86 (31%)
PTZ00168 17..280 CDD:185494 68/287 (24%)
Mito_carr 107..190 CDD:278578 16/89 (18%)
Mito_carr <215..282 CDD:278578 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.