DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and Tpc1

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:312 Identity:82/312 - (26%)
Similarity:129/312 - (41%) Gaps:35/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HAKRAAF-QVLAGGSAGFLEVCIMQPLDVVKTRIQIQATP-APNAAALG----EVHYNGVFDCFA 68
            |:.|... |:||||.:..:.....|||||:|.|.|:|..| ..|||..|    ...|..:.....
  Fly    23 HSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVK 87

  Fly    69 KMYRHEGISSYWKGIMPPILAETPKRAIKFLVFEQTKPLFQFGS--PTPTPLTFSLAGLTAGTLE 131
            .:||.||:.::|||..|..:........:|..:||...:.:..|  .....|:..|.|..||...
  Fly    88 TIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAA 152

  Fly   132 AIAVNPFEVVK---VAQQADRQKKMLSTFAVAKGIIQQDG-----LGFSGLNKGITATMGRNGVF 188
            .|...|.:|::   :||  |..|...:.......|::|:|     .|.|.....||..||.|   
  Fly   153 VIISTPLDVIRTRLIAQ--DTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTN--- 212

  Fly   189 NMVYFGFYHSVKNVVPEYKE----SHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQ------G 243
                |..|....:....:.|    |.|.....:.:|..:|.|:..:..|||:.|.|:|      .
  Fly   213 ----FMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESN 273

  Fly   244 PQPVPGQIKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            .|.....::..|....:.:..|:||.|.||||:.|.:::.....|:...:::
  Fly   274 RQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 30/98 (31%)
PTZ00169 19..301 CDD:240302 79/302 (26%)
Mito_carr 122..207 CDD:278578 23/92 (25%)
Mito_carr 209..305 CDD:278578 23/93 (25%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 30/93 (32%)
PTZ00169 33..329 CDD:240302 79/302 (26%)
Mito_carr 153..222 CDD:278578 19/77 (25%)
Mito_carr 233..328 CDD:278578 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.