DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG6893

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:309 Identity:63/309 - (20%)
Similarity:115/309 - (37%) Gaps:85/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIM 84
            :||.||.:..|...|.|:::.|:.:.......|:.|.:.            .|..|..|.:.|:.
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQA------------IRTHGFISLYDGLS 72

  Fly    85 PPILAETPKRAIKFLVFEQTKPLFQFGSPT---PTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQ 146
            ..:|.:....:::|.::|..|.  ....|.   ...|..:|||..||    :...|.|::....|
  Fly    73 AQLLRQLTYTSMRFHLYEMGKE--HLDDPAGLLDKVLVAALAGCVAG----VVGTPMELINTRMQ 131

  Fly   147 ADR------QKKMLSTFAVAKGIIQQDGL-------GFSGLNKGI--------TATMGRNGVFN- 189
            .:|      :....:.|         |||       ||:.|..|.        ..|:.:|..:: 
  Fly   132 VNRALPKETRWNYRNVF---------DGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQ 187

  Fly   190 --MVYFGFYHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIK 252
              .:|..|:|.      ::..:.|..:..||..|:.|.:.                 :|:. .::
  Fly   188 AKQIYAEFFHM------KHDNTLLHLISSVTAAFVCGPII-----------------KPIE-NLR 228

  Fly   253 Y------RGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            |      |..::|:..:.| .|.|..::|:||.::|:.|...|..|.||
  Fly   229 YLRMVDSRRLINSISYMMR-FGSRGPFRGMVPYVLRMVPNTVITFLSFE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 18/91 (20%)
PTZ00169 19..301 CDD:240302 63/309 (20%)
Mito_carr 122..207 CDD:278578 22/108 (20%)
Mito_carr 209..305 CDD:278578 21/93 (23%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 18/89 (20%)
Mito_carr 98..192 CDD:395101 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.