DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and Mpcp2

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:208 Identity:56/208 - (26%)
Similarity:98/208 - (47%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GQQHDISHAKRAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCF 67
            |:::  ::..|.:..:.|..||.|.....:.|.:..|  ::||..|.         :.|...:..
  Fly   150 GEEN--AYLYRTSLYLAASASAEFFADIALAPFEAAK--VKIQTIPG---------YANNFREAV 201

  Fly    68 AKMYRHEGISSYWKGIMPPILAETPKRAIKFLVFEQT-KPLFQFGSPTPTP---------LTFSL 122
            .||.:.||:::::||::|..:.:.|...:||..||:| :.|:::..|.|..         :||: 
  Fly   202 PKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFA- 265

  Fly   123 AGLTAGTLEAIAVNPFEVVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGV 187
            ||..||...|:..:|.:|| |::.  .|.|..|..:|||      .|||||:..|:|..:...|.
  Fly   266 AGYIAGVFCAVVSHPADVV-VSKL--NQAKGASAISVAK------SLGFSGMWNGLTPRIIMIGT 321

  Fly   188 FNMVYFGFYHSVK 200
            ...:.:..|..||
  Fly   322 LTALQWFIYDGVK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 24/94 (26%)
PTZ00169 19..301 CDD:240302 54/192 (28%)
Mito_carr 122..207 CDD:278578 26/79 (33%)
Mito_carr 209..305 CDD:278578
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578
Mito_carr <175..245 CDD:278578 20/80 (25%)
Mito_carr 260..338 CDD:278578 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.