DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and SCaMC

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:313 Identity:73/313 - (23%)
Similarity:123/313 - (39%) Gaps:60/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKG 82
            ::|||.||.:......|||.:|..:|:|            ....|:.:|...|....|..|.|:|
  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYLQVQ------------TQRMGISECMHIMLNEGGSRSMWRG 341

  Fly    83 IMPPILAETPKRAIKFLVFEQTKPLFQ--FGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQ 145
            ....:|...|:.|.||..:||.|.|.:  .||...:.:....||..||.:....:.|.||:|...
  Fly   342 NGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRL 406

  Fly   146 QADRQKKMLSTFAVAKGIIQQDG---------------LGFSGLNKGITATMGRNGVFNMVYFGF 195
            ...|..:.......|..|.:|:|               |.::|::..:..|:.|..:.|      
  Fly   407 ALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIAN------ 465

  Fly   196 YHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQ-------------PV 247
             |. .|..|       .||..:..|..:.||....:.|..:.::|:|...             |:
  Fly   466 -HD-NNEQP-------SFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPL 521

  Fly   248 PGQIKYRGTLSSMGI---VYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYS 297
            .....:.|..:..|:   :.|:||...||:|:.|..:::.|..:|..:|:||:
  Fly   522 KSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYT 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 27/95 (28%)
PTZ00169 19..301 CDD:240302 73/312 (23%)
Mito_carr 122..207 CDD:278578 21/99 (21%)
Mito_carr 209..305 CDD:278578 23/105 (22%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 27/92 (29%)
Mito_carr 375..463 CDD:278578 17/87 (20%)
Mito_carr 470..581 CDD:278578 24/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.