DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG18418

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:139/276 - (50%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMP 85
            ||::|.|..||:||||::|||:||..|       ||...|...|:..:|:.::|||.|.:.|:..
  Fly    21 GGTSGMLATCIVQPLDLLKTRMQISGT-------LGTREYKNSFEVLSKVLKNEGILSLYNGLSA 78

  Fly    86 PILAETPKRAIKFLVFEQTKPLFQ--FGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQAD 148
            .:|.:....:.|..|::.....::  ||: .|:.:.....|:.||...|:..||.||..:...:|
  Fly    79 GLLRQATYTSAKMGVYQMELDWYRKNFGN-YPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSD 142

  Fly   149 RQ---------KKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVVP 204
            .:         |.:...|.   .|::.:|:  ..|.:|...|:||..|.|||....|..:||.:.
  Fly   143 NRLMPEDRRNYKNVGDAFV---RIVKDEGV--VALWRGCLPTVGRAMVVNMVQLASYSLMKNQLH 202

  Fly   205 EYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVYREEGF 269
            .|....:..  .:|...::|.|....::|.|:||:|||..:.:.|:.:|.||:..:..|.:.||.
  Fly   203 GYLSEGIPL--HLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGA 265

  Fly   270 RALYKGLVPKIMRLGP 285
            .|::||..|.:||:||
  Fly   266 FAVWKGFTPYLMRMGP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 30/92 (33%)
PTZ00169 19..301 CDD:240302 83/276 (30%)
Mito_carr 122..207 CDD:278578 25/93 (27%)
Mito_carr 209..305 CDD:278578 25/77 (32%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/94 (33%)
PTZ00169 18..296 CDD:240302 83/276 (30%)
Mito_carr 109..205 CDD:278578 26/100 (26%)
Mito_carr 208..300 CDD:278578 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.