DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and PMP34

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:296 Identity:65/296 - (21%)
Similarity:119/296 - (40%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGI 83
            ::|.:.|.:.:....|||.|::|:|::..        |:|  ........::...||..|.::|:
  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLEEA--------GDV--RSTRQVIKEIVLGEGFQSLYRGL 74

  Fly    84 MPPILAETPKRAIKFLVFEQTKPLFQFGSPTP-TPLTFSLAGLTAGTLEAIAVNPFEVV------ 141
            .|.:.:......:.|..|...|.:...|||:. :.|...|.|..||.:..:...||.||      
  Fly    75 GPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRM 139

  Fly   142 -KVAQQADRQKKMLSTFAVA-KGIIQQDGLGFSGLNKGITATMGRNGVFN-MVYFGFYHSVKNVV 203
             .||..:|...|........ |.:.:::|:  :||..|...::..  |.| .:.|..|..:|..:
  Fly   140 RNVAGTSDEVNKHYKNLLEGLKYVAEKEGI--AGLWSGTIPSLML--VSNPALQFMMYEMLKRNI 200

  Fly   204 PEYKESHLEFLRKVTIGFLAGTLACFVNIPFDV--------AKSRIQGPQPVPGQI-KYRGTLSS 259
            ..:....:..|....||.:|...|..:..|..:        :|.....|....|.. :...||..
  Fly   201 MRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLEL 265

  Fly   260 MGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            |..:.:.:|.|.|::||..||::.....|::.:.:|
  Fly   266 MISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 18/92 (20%)
PTZ00169 19..301 CDD:240302 65/296 (22%)
Mito_carr 122..207 CDD:278578 22/93 (24%)
Mito_carr 209..305 CDD:278578 21/96 (22%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 17/85 (20%)
Mito_carr 105..202 CDD:278578 23/100 (23%)
Mito_carr 214..303 CDD:278578 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.