DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and Tpc2

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:318 Identity:92/318 - (28%)
Similarity:142/318 - (44%) Gaps:52/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVH----YNGVFDCFAKMYRHEGIS 77
            |.:.||.||.....|.|||||:|.|.|:|..|..|       |    |.||...|..:|..||:.
  Fly    12 QAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTN-------HKGSKYRGVIHAFKSVYAEEGMR 69

  Fly    78 SYWKGIMPPILAETPKRAIKFLVFEQTKPL---FQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFE 139
            ..::|.....:.......::|..:||.:.:   |.:....|. |.|.:.|..||.|.|:|..||:
  Fly    70 GMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPF-LMFFICGGIAGCLGAVAAQPFD 133

  Fly   140 VVK---VAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMV--YFGFYHSV 199
            ||:   ||.....::..::||...:.:.:.:  |:.||::|:..|:.:  ||.:|  .|.||..:
  Fly   134 VVRTQMVAADPSSRRSQMNTFTGLRKVYKME--GWMGLSRGLPFTLVQ--VFPLVGANFLFYKYL 194

  Fly   200 KNVV-----PEYK-ESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQ-----------GPQPV 247
            ...|     |:.: |.|..||  ...|.|:|.||..:..|.|:.|.|||           |..|.
  Fly   195 NAAVLMAKPPDQRQEIHGAFL--FLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPE 257

  Fly   248 PGQIKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYSYDYLLHNY 305
            ...|     |..:...:||||....|||::|.:::.|    ::..|:...||....:|
  Fly   258 CPTI-----LGCITTTFREEGIGGFYKGMLPTLLKAG----LMSAVYFSIYDMFKRHY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 29/100 (29%)
PTZ00169 19..301 CDD:240302 90/310 (29%)
Mito_carr 122..207 CDD:278578 27/94 (29%)
Mito_carr 209..305 CDD:278578 30/106 (28%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 86/303 (28%)
Mito_carr 23..99 CDD:278578 24/82 (29%)
Mito_carr 108..194 CDD:278578 28/90 (31%)
Mito_carr 216..307 CDD:278578 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.