Sequence 1: | NP_569856.2 | Gene: | CG5254 / 31020 | FlyBaseID: | FBgn0040383 | Length: | 306 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286628.1 | Gene: | Mpcp1 / 37297 | FlyBaseID: | FBgn0034497 | Length: | 374 | Species: | Drosophila melanogaster |
Alignment Length: | 215 | Identity: | 62/215 - (28%) |
---|---|---|---|
Similarity: | 93/215 - (43%) | Gaps: | 40/215 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 RAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGIS 77
Fly 78 SYWKGIMPPILAETPKRAIKFLVFEQT-KPLFQFGSPTPTP---------LTFSLAGLTAGTLEA 132
Fly 133 IAVNPFE-VVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFY 196
Fly 197 HSVKNVV-------PEYKES 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5254 | NP_569856.2 | Mito_carr | 18..112 | CDD:278578 | 27/94 (29%) |
PTZ00169 | 19..301 | CDD:240302 | 61/209 (29%) | ||
Mito_carr | 122..207 | CDD:278578 | 28/92 (30%) | ||
Mito_carr | 209..305 | CDD:278578 | 1/1 (100%) | ||
Mpcp1 | NP_001286628.1 | Mito_carr | 71..160 | CDD:278578 | |
Mito_carr | <188..258 | CDD:278578 | 23/80 (29%) | ||
Mito_carr | 273..350 | CDD:278578 | 28/87 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45441835 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |