DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG18324

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:318 Identity:81/318 - (25%)
Similarity:125/318 - (39%) Gaps:66/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRH-----------E 74
            ||:|....|....|:||||||:|:|          ||:...|.   :.|.|||           :
  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQ----------GELAARGT---YVKPYRHLPQAMLQIVLND 60

  Fly    75 GISSYWKGIMPPILAETPKRAIKFLVFEQTKPL-----------FQFGSPTPTPLTFSLAGLTAG 128
            |:.:..||:.|.:..:....:::..|:.....|           |..|      :.|...|...|
  Fly    61 GLLALEKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRG------MFFGALGGCTG 119

  Fly   129 TLEAIAVNPFEVVKVAQQADRQKKMLSTFAVA---KGIIQQDGL-------GFSGLNKGITATMG 183
            |..|   :||.::|..|.|    :.:.:.||.   |.....|.|       |.||..:....::.
  Fly   120 TYFA---SPFYMIKAQQHA----QAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLN 177

  Fly   184 RNGVFNMVYFGFYHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVP 248
            |..|.:.|..|.:...|:::.:........|.....|..:|||....|.||||..:|:.. |||.
  Fly   178 RTLVASSVQIGTFPKAKSLLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYN-QPVD 241

  Fly   249 GQ---IKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYSYDYLLH 303
            .:   :.|:|.:.....::|.||...:|||..|...|..|...:..:.||    .|||
  Fly   242 EKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE----KLLH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 27/112 (24%)
PTZ00169 19..301 CDD:240302 78/314 (25%)
Mito_carr 122..207 CDD:278578 22/94 (23%)
Mito_carr 209..305 CDD:278578 30/98 (31%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/90 (27%)
PTZ00169 5..293 CDD:240302 78/314 (25%)
Mito_carr 101..201 CDD:278578 25/112 (22%)
Mito_carr 204..296 CDD:278578 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.