DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG8323

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:303 Identity:68/303 - (22%)
Similarity:123/303 - (40%) Gaps:34/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEV--HYNGVFDCFAKMYRHEGI 76
            |....:.||.|.........|::|:|||||:|.    ..||.|..  .|.|:.:.|..:.:::||
  Fly     2 ATSDFVLGGLASVGATFFTNPIEVIKTRIQLQG----ELAARGTYVEPYKGIVNAFITVAKNDGI 62

  Fly    77 SSYWKGIMPPILAETPKRAIKFLVFEQT---------KPLFQFGSPTPTPLTFSLAGLTAGTLEA 132
            :...||:.|.:..:....:.:..::.:.         |....:|...       |.|...|.:..
  Fly    63 TGLQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGL-------LWGAIGGVVGC 120

  Fly   133 IAVNPFEVVKVAQQADRQKKMLSTFAVA--------KGIIQQDGLGFSGLNKGITATMGRNGVFN 189
            ...:||.::|...|:...|::...:..|        :.|..::|:  .||.:|..|.:.|..:.:
  Fly   121 YFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGV--RGLWRGSVAALPRAALGS 183

  Fly   190 MVYFGFYHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRI--QGPQPVPGQIK 252
            ......:...|.::.:|.......|...:.|.:||::......|.||..:|:  ||.......:.
  Fly   184 GAQIATFGKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLL 248

  Fly   253 YRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            |||.|.....:.|.||...:|||.....:|:.|...::||.|:
  Fly   249 YRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 23/104 (22%)
PTZ00169 19..301 CDD:240302 67/298 (22%)
Mito_carr 122..207 CDD:278578 17/92 (18%)
Mito_carr 209..305 CDD:278578 25/89 (28%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 22/86 (26%)
PTZ00169 5..293 CDD:240302 67/300 (22%)
Mito_carr 101..200 CDD:278578 18/107 (17%)
Mito_carr 206..301 CDD:278578 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.