DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and CG8026

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:310 Identity:84/310 - (27%)
Similarity:131/310 - (42%) Gaps:37/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SHAKRAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEV-HYNGVFDCFAKMYR 72
            :|.|..  .::||.|.|.:...|:.|||::|.|.      |.|......| .|.|:...|..::|
  Fly    19 AHVKYE--HLVAGVSGGVVSTLILHPLDLIKIRF------AVNDGRTATVPQYRGLSSAFTTIFR 75

  Fly    73 HEGISSYWKGIMPPILAETPKRAIKFLVFEQTKPLFQFGSPTPT--PLTFSLAGLTAGTLEAIAV 135
            .||....:||:.|.:........:.|:.:...|...|.|:.|..  |....||...:|.|..:..
  Fly    76 QEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLT 140

  Fly   136 NPFEVVK--VAQQADRQKKMLSTFAVAKGIIQQDGL-----GFSGLNKGITATMGRNGV-FNMVY 192
            ||..|||  :..|.|     .::.|..:|:|...|.     |..||.:|...  |..|| ...:.
  Fly   141 NPIWVVKTRLCLQCD-----AASSAEYRGMIHALGQIYKEEGIRGLYRGFVP--GMLGVSHGAIQ 198

  Fly   193 FGFYHSVKNVVPEYKESHLEFLRKVTIGFLA-----GTLACFVNIPFDVAKSRIQGPQPVPGQIK 252
            |..|..:||...||::..:: .:..|..:||     ..:|.....|:.|.::|:|....     :
  Fly   199 FMTYEELKNAYNEYRKLPID-TKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHHH-----R 257

  Fly   253 YRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYSYDYLL 302
            |.||...:...:|.||:|..||||...:.|:.|...:..||:|....:||
  Fly   258 YNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 25/94 (27%)
PTZ00169 19..301 CDD:240302 80/297 (27%)
Mito_carr 122..207 CDD:278578 27/92 (29%)
Mito_carr 209..305 CDD:278578 26/99 (26%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 77/288 (27%)
Mito_carr 23..115 CDD:278578 25/99 (25%)
Mito_carr 119..213 CDD:278578 28/100 (28%)
Mito_carr 220..307 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.