DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and Dic3

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:171 Identity:48/171 - (28%)
Similarity:80/171 - (46%) Gaps:17/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GTLEAIAV---NPFEVVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFN 189
            |...||||   :|.:::||..|...|....:...:.|||.::.|:  .|...||:|:..|...:.
  Fly    16 GVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGI--LGFYNGISASWFRQLTYT 78

  Fly   190 MVYFGFYHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIK-- 252
            ...|..|.:.|:.|...|.|     .|:.:...||.:...|.:|.||...|:|....:|.:.:  
  Fly    79 TTRFALYEAGKDYVDTQKVS-----SKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRN 138

  Fly   253 YRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLV 293
            |:.....:..:|:|||..:|::|.||.:.|     |:||.:
  Fly   139 YKHVFDGLFRIYKEEGVSSLFRGTVPAVSR-----AVLLTI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578
PTZ00169 19..301 CDD:240302 48/171 (28%)
Mito_carr 122..207 CDD:278578 23/81 (28%)
Mito_carr 209..305 CDD:278578 24/87 (28%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 48/171 (28%)
Mito_carr 15..91 CDD:278578 22/76 (29%)
Mito_carr 93..187 CDD:278578 25/92 (27%)
Mito_carr 200..281 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.