DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and colt

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:129/278 - (46%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGI 83
            |.||..|...|....|||.:|.|:|....|||....|    |.|.|||.||..::||:...:||:
  Fly    20 LTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPL----YRGTFDCAAKTIKNEGVRGLYKGM 80

  Fly    84 MPPILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFS---LAGLTAGTLEAIAVNPFEVVKV-- 143
            ..|:....|..|:.|..:...|.|.|.|.  ...||:.   :||..:|....:.:.|.|.:||  
  Fly    81 SAPLTGVAPIFAMCFAGYALGKRLQQRGE--DAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLL 143

  Fly   144 -AQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVVPEYK 207
             .||....::..:......|.:.::| |...:.||..|||.|:...|.:||..|.::::|.....
  Fly   144 QTQQGQGGERKYNGMIDCAGKLYKEG-GLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKS 207

  Fly   208 ES-HLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQ-GPQPVPGQIKYRGTLSSMGIVYREEGFR 270
            |: .:.....:..|.:||.....:.:|.||.|||:| .|:   |..|: |..|....:..::|..
  Fly   208 ETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPE---GTYKH-GIRSVFKDLIVKDGPL 268

  Fly   271 ALYKGLVPKIMRLGPGGA 288
            |||:|:.|.::|..|..|
  Fly   269 ALYRGVTPIMLRAFPANA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 33/92 (36%)
PTZ00169 19..301 CDD:240302 84/278 (30%)
Mito_carr 122..207 CDD:278578 23/87 (26%)
Mito_carr 209..305 CDD:278578 24/82 (29%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/90 (36%)
Mito_carr 112..202 CDD:395101 24/90 (27%)
Mito_carr 210..299 CDD:395101 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.