DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and Ucp4A

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:278 Identity:76/278 - (27%)
Similarity:129/278 - (46%) Gaps:24/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMPPILAETPKRAIKF 98
            |||:.|||:|||...|.::|....:.|.|:......:.|.||....|:|:.|.:........::.
  Fly    60 PLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRI 124

  Fly    99 LVFEQTKPLFQFGSPTPTPLTFS-LAGLTAGTLEAIAVNPFEVVKVAQQADRQKKML-------S 155
            ..::..:..|........|:..| |.|:|||.:.....:|.::|||..|.:.:::::       |
  Fly   125 CSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHS 189

  Fly   156 TFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVV------PEYKESHLEFL 214
            .....:.|:|:.|:  .||.||....:.|..:.|:.....|.::|:::      |:....|:  |
  Fly   190 AGHAFRQIVQRGGI--KGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHV--L 250

  Fly   215 RKVTIGFLAGTLACFVNIPFDVAKSRIQG-PQPVPGQ-IKYRGTLSSMGIVYREEGFRALYKGLV 277
            ..|..||    :|..:..|.||.|:||.. |....|: :.|||::..:.....:|||.|||||.:
  Fly   251 ASVCAGF----VAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFL 311

  Fly   278 PKIMRLGPGGAILLLVFE 295
            |..:|:.|......|.||
  Fly   312 PCWIRMAPWSLTFWLSFE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 20/77 (26%)
PTZ00169 19..301 CDD:240302 76/278 (27%)
Mito_carr 122..207 CDD:278578 23/97 (24%)
Mito_carr 209..305 CDD:278578 31/89 (35%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 76/278 (27%)
Mito_carr 39..138 CDD:278578 20/77 (26%)
Mito_carr 142..239 CDD:278578 24/98 (24%)
Mito_carr 248..336 CDD:278578 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.