DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5254 and sesB

DIOPT Version :9

Sequence 1:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:293 Identity:72/293 - (24%)
Similarity:133/293 - (45%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGGSAGFLEVCIMQPLDVVKTRIQI-----QATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSY 79
            |||.:..:....:.|::.||..:|:     |.:|        :..|.|:.|||.::.:.:|.||:
  Fly    29 AGGISAAVSKTAVAPIERVKLLLQVQHISKQISP--------DKQYKGMVDCFIRIPKEQGFSSF 85

  Fly    80 WKGIMPPILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFSLAGL-----TAGTLEAIAVNPFE 139
            |:|.:..::...|.:|:.|...::.|.:|..|....|......||.     .||......|.|.:
  Fly    86 WRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLD 150

  Fly   140 VVKVAQQADR----QKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVK 200
            ..:....||.    |::..........|.:.||:  .||.:|...::....::...|||||.:.:
  Fly   151 FARTRLAADTGKGGQREFTGLGNCLTKIFKSDGI--VGLYRGFGVSVQGIIIYRAAYFGFYDTAR 213

  Fly   201 NVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRI---QGPQPVPGQIKYRGTLSSMGI 262
            .::|:.|.:.:..  ...|..:..|:|..|:.|||..:.|:   .|.:..  ::.|:.||.....
  Fly   214 GMLPDPKNTPIYI--SWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKAT--EVIYKNTLHCWAT 274

  Fly   263 VYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295
            :.::||..|.:||....|:| |.|||.:|::::
  Fly   275 IAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 24/96 (25%)
PTZ00169 19..301 CDD:240302 72/293 (25%)
Mito_carr 122..207 CDD:278578 21/93 (23%)
Mito_carr 209..305 CDD:278578 24/90 (27%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 24/94 (26%)
PTZ00169 23..312 CDD:240302 72/293 (25%)
Mito_carr 124..220 CDD:278578 21/97 (22%)
Mito_carr 223..312 CDD:278578 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.