DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and Chl1

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:1128 Identity:263/1128 - (23%)
Similarity:449/1128 - (39%) Gaps:177/1128 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LQCHALGYPQPTYRWLKDGVPVGDFSSSQFYRFHSTR----------REDAGSYQCIARNDAGSI 147
            ::|.|.|.|:|.:.|.||..|. |.|..:...|:::.          ....|.|:|.|.|..|:.
  Rat    54 IECEAKGNPEPKFSWTKDDKPF-DLSDPRIIAFNNSGTFRIPNEGHISHFQGKYRCFASNRLGTA 117

  Fly   148 FSEKSDVVVAYMGIFENTTEGRLTVISGHPAIFDMPPIESIPVPSVMWQS-EDGPLNYDIKYAFT 211
            .||:.:.:|..:..|.......:.|..|...:....|.:..|...:.|.: |...:..|.:...:
  Rat   118 ISEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGHPPLHIYWMNIELEHIEQDERVYMS 182

  Fly   212 HANQLIILSADEND-RKGYRAKA-----------------INTQLGKEESSAFVHLNVSGDPYIE 258
            ....|...:.:|.| |..|...|                 :|:.....:||:...::...:...:
  Rat   183 QKGDLYFANVEEKDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSLKHANDSSSSTEISNQANSIKQ 247

  Fly   259 VAPEIIVRPQDV-----KVKVGTGVVELQCIANARPLHELETLWLKDGLAVETAGVRHTLNDPWN 318
            ..|::::.|..:     |..:....:.|:|.|...|..::|  |.|  |..|....|.|: :...
  Rat   248 RKPKLLLPPAQIGSASSKTVLKGDTLLLECFAEGLPTPQIE--WSK--LGSELPKGRATI-EIHE 307

  Fly   319 RTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQIL--EPPLFFTPMRAETFGEFGGQVQLT 381
            :||.:...:....|.|.|......|     .||....::  |||.:....::..:.. |....|.
  Rat   308 KTLKIENVSYQDRGNYRCTANNLLG-----KASHDFHVIVEEPPRWKKKPQSAVYST-GSNGILL 366

  Fly   382 CDVVGEPTPQVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSAST 446
            |:..|||.|.:||..|...::.|...|......:  :....|..:..|::||.|.|..|...|: 
  Rat   367 CEAEGEPQPTIKWRVNGLPIENHPFPGDVMFPRE--ISFTNLQPNHTAVYQCEASNIHGTILAN- 428

  Fly   447 WLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPP----- 506
                                                              |:..::::.|     
  Rat   429 --------------------------------------------------ANIDVVDVVPLIQTK 443

  Fly   507 --QNVTALDGKDATISCRAVGSPNPNITW-IYNETQLVDISSRVQILESGDLLISNIRSVDAGLY 568
              :|...:.|..|.:.|....||...:.| :.:||..:: ..|....|:|.|.|......|||.|
  Rat   444 NEENYETVVGYSAFLHCEYFASPKATVVWEVADETHPLE-GGRYHTHENGTLEIERTTEEDAGSY 507

  Fly   569 ICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYN--IDWYREGQ 631
            .|...|..|.....|.|.:...|::...|.:..:.......|.|:...|..:.::  :.|.::|:
  Rat   508 SCWVDNTMGKAVITANLDIRNATKLRVFPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGE 572

  Fly   632 SSTPISNSQRIGVQADG-QLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVE 695
             :..::.::...:..|| .|.|..:...|.|.|:|...:...:.:...:::|:.:|.||.|:   
  Rat   573 -AFEMNGTEDGRIVIDGANLTISNISGEDQGIYSCSAQTALDSTSGKTQVTVLGVPDPPRNL--- 633

  Fly   696 RLPEPQQRSINVSWTPGFDGNSPISKFIIQ---RREVSELGPVPDPLLNWITELSNVSADQRWIL 757
            .|.|.|.||:.:||..|.|.||.||::|::   .||  |.|       .| .||:.|..::..::
  Rat   634 LLSERQNRSVRLSWEAGDDHNSKISEYIVEFEGNRE--EPG-------KW-EELTRVRGEETDVV 688

  Fly   758 LENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLE 822
            |. |.....|||||:|||.||:...|:||:..|.|..||...|......|....|:|.:|:|...
  Rat   689 LP-LAPYVRYQFRVTAVNEVGKSHSSQPSDHHETPPAAPDKNPHNIRVQASQPKEMIIKWEPLKS 752

  Fly   823 EHRNGQILGYILRYRLFGYNNVP--WSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVY 885
            ..:||..|.|.:.::..|   .|  |..:.:||...|   :.....:..|.||:.|.|.:|.|..
  Rat   753 MEQNGPGLEYRVSWKPQG---APEEWEEETVTNHTLR---VMTPTVYAPYDVQVQAINQLGSGPE 811

  Fly   886 TEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQ-RRLIDGEWR 949
            .:...:.:.|..|...|...:|:.:|||..:..|:....:.::|:.:||:|..|: :.|:||.  
  Rat   812 PQPVTLYSGEDYPSTAPVIHRVDVMNSTLVKVTWSSIPKETVHGLLRGYQINWWKTKSLLDGR-- 874

  Fly   950 DIERRMKTVPPSLIDPL----AEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVP 1010
                    ..|..::.|    ...:.::..||.|:|::::||.:...|.|..|......|.:.||
  Rat   875 --------THPKEVNILRFSGQRNSGMVPSLEPFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVP 931

  Fly  1011 DEVTGLHFDDVSDRSVKVLWAPPRASNGILTGYTVRYQVKDRPDT-----LKSFNLTA-DDTELT 1069
            ::.:.|....|...:..:.|..|:..||.||||.::||:.:  ||     |...|:|. ..:...
  Rat   932 EQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIIN--DTYELGELNEINVTTPSKSSWH 994

  Fly  1070 VNQLQATTHYWFEIVAWTRVGSGIP---KTAT----------IQSGVEPVLPHAPTALALSNIEA 1121
            ::.|.|||.|.|.:.|.|..|.|.|   :.||          |..||.......|..:.:...| 
  Rat   995 LSNLNATTKYKFYLKACTSRGCGKPISEEGATLGEGSKGIRKITEGVNVTQKSHPVEVLVPGAE- 1058

  Fly  1122 FSVVLQFTPGFDGNSSITKWKVE 1144
             .:|...|..:..|.||.:..:|
  Rat  1059 -HIVHLMTKNWGDNDSIFQDVIE 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046 16/58 (28%)
Ig 280..344 CDD:409353 16/63 (25%)
Ig strand B 280..283 CDD:409353 1/2 (50%)
Ig strand C 292..298 CDD:409353 1/5 (20%)
Ig strand E 319..323 CDD:409353 2/3 (67%)
Ig strand F 333..338 CDD:409353 2/4 (50%)
Ig 360..451 CDD:472250 21/90 (23%)
Ig strand B 378..382 CDD:409353 1/3 (33%)
Ig strand C 391..395 CDD:409353 1/3 (33%)
Ig strand E 416..420 CDD:409353 0/3 (0%)
Ig strand F 430..435 CDD:409353 2/4 (50%)
Ig strand G 443..446 CDD:409353 1/2 (50%)
Ig 502..587 CDD:472250 24/92 (26%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 530..534 CDD:409353 1/4 (25%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 14/92 (15%)
Ig strand B 608..612 CDD:409353 1/3 (33%)
Ig strand C 623..627 CDD:409353 0/5 (0%)
Ig strand E 648..652 CDD:409353 2/4 (50%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 0/2 (0%)
FN3 686..789 CDD:238020 41/105 (39%)
FN3 798..893 CDD:238020 23/96 (24%)
FN3 901..1005 CDD:238020 25/108 (23%)
FN3 <960..>1261 CDD:442628 55/208 (26%)
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
Chl1XP_038964701.1 Ig 34..125 CDD:472250 20/71 (28%)
Ig strand B 52..56 CDD:409353 0/1 (0%)
Ig strand C 65..69 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
Ig strand G 119..122 CDD:409353 2/2 (100%)
IgI_2_L1-CAM_like 134..224 CDD:409432 13/89 (15%)
Ig strand A 134..137 CDD:409432 0/2 (0%)
Ig strand A' 139..143 CDD:409432 0/3 (0%)
Ig strand B 146..154 CDD:409432 0/7 (0%)
Ig strand C 161..167 CDD:409432 1/5 (20%)
Ig strand C' 170..173 CDD:409432 0/2 (0%)
Ig strand D 179..183 CDD:409432 0/3 (0%)
Ig strand E 185..189 CDD:409432 1/3 (33%)
Ig strand F 200..208 CDD:409432 2/7 (29%)
Ig strand G 211..224 CDD:409432 0/12 (0%)
Ig 261..343 CDD:472250 20/91 (22%)
Ig strand B 273..277 CDD:409353 1/3 (33%)
Ig strand C 286..290 CDD:409353 1/5 (20%)
Ig strand E 308..312 CDD:409353 2/3 (67%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 1/2 (50%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 21/140 (15%)
Ig strand B 363..367 CDD:409367 1/3 (33%)
Ig strand C 376..380 CDD:409367 1/3 (33%)
Ig strand E 399..403 CDD:409367 0/5 (0%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 1/53 (2%)
Ig 447..524 CDD:472250 22/77 (29%)
Ig strand B 456..460 CDD:409353 1/3 (33%)
Ig strand C 469..473 CDD:409353 0/3 (0%)
Ig strand E 492..496 CDD:409353 2/3 (67%)
Ig strand F 506..511 CDD:409353 2/4 (50%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Ig 528..627 CDD:472250 16/99 (16%)
Ig strand B 547..551 CDD:409353 1/3 (33%)
Ig strand C 564..568 CDD:409353 0/3 (0%)
Ig strand E 589..593 CDD:409353 1/3 (33%)
Ig strand F 603..608 CDD:409353 2/4 (50%)
Ig strand G 616..619 CDD:409353 0/2 (0%)
FN3 <626..>867 CDD:442628 81/260 (31%)
FN3 627..716 CDD:238020 39/102 (38%)
FN3 832..926 CDD:238020 24/103 (23%)
FN3 931..1026 CDD:238020 29/96 (30%)
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.