DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and Musk

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_112323.2 Gene:Musk / 81725 RGDID:3211 Length:868 Species:Rattus norvegicus


Alignment Length:550 Identity:128/550 - (23%)
Similarity:206/550 - (37%) Gaps:149/550 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 VSASARLQILEPPLFFTPMRAETFGEFGGQV-QLTCDVVGEPTPQVKWFRNAESVDAHIESGRYT 411
            |:.|...::.:.|:..||:  ||......:| ...|.|...|.|::.|.||  .:...:...||:
  Rat    16 VAFSGTEKLPKAPVITTPL--ETVDALVEEVATFMCAVESYPQPEISWTRN--KILIKLFDTRYS 76

  Fly   412 LNTDNTLVIKKLILD-DAAMFQCLAINEAG---ENSASTWLRVKTKTAKNRVKRLAQPRILRVRA 472
            :..:..|:....:.| |..::.|.|.|..|   |:..:  |:||.|           |:|.|   
  Rat    77 IRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGA--LQVKMK-----------PKITR--- 125

  Fly   473 SHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIYNE 537
                                            ||.||..::|..|.:.|..:|:|.|:::||..:
  Rat   126 --------------------------------PPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGD 158

  Fly   538 TQLVDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAY-----LSVLVRTQIIQPP 597
            :.|.: :||:.:||||.|.|.|::..|||.|.||..|..|:    ||     |.|.|..:|::.|
  Rat   159 SALRE-NSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGT----AYSKLVKLEVEVFARILRAP 218

  Fly   598 VDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQ--SSTPISNSQRIGVQADGQLEIQAVRASDV 660
            ....|..|...||:|.....| || .|.|...|.  ||..|..:.:..| .|.:|::...:.   
  Rat   219 ESHNVTFGSFVTLRCTAIGMP-VP-TISWIENGNAVSSGSIQENVKDRV-IDSRLQLFITKP--- 277

  Fly   661 GSYACVVTSPGGNE----TRAARLSVIE----------------------------LPFPPSNVK 693
            |.|.|:.|:..|.:    ..||.:|:.|                            |.|  .|..
  Rat   278 GLYTCIATNKHGEKFSTAKAAATVSIAEWSKSQKESKGYCAQYRGEVCDAVLVKDSLVF--FNTS 340

  Fly   694 VERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSEL------GPVPDPL---LNWITELSNV 749
            .....|.|:..|:.:|.. ....||:.:...:....:.|      |.:|.|:   ..:...:..:
  Rat   341 YPDPEEAQELLIHTAWNE-LKAVSPLCRPAAEALLCNHLFQECSSGVLPTPMPICREYCLAVKEL 404

  Fly   750 SADQRWILLENLKAATVYQFRVSAVNRVGEGS--PS---EPS-------------NVVELPQEAP 796
            ...:.|:.:|......:|:..:..: .|.|.|  ||   :|:             |:...|....
  Rat   405 FCAKEWLAMEGKTHRGLYRSGMHFL-PVPECSKLPSMHQDPTACTRLPYLDYKKENITTFPSITS 468

  Fly   797 SGPPVGF-----------VGSARSMSEIIT 815
            |.|.|..           |..|.||:.||:
  Rat   469 SKPSVDIPNLPASTSSFAVSPAYSMTVIIS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046
Ig 280..344 CDD:409353
Ig strand B 280..283 CDD:409353
Ig strand C 292..298 CDD:409353
Ig strand E 319..323 CDD:409353
Ig strand F 333..338 CDD:409353
Ig 360..451 CDD:472250 24/95 (25%)
Ig strand B 378..382 CDD:409353 1/4 (25%)
Ig strand C 391..395 CDD:409353 0/3 (0%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 1/4 (25%)
Ig strand G 443..446 CDD:409353 0/2 (0%)
Ig 502..587 CDD:472250 33/89 (37%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 530..534 CDD:409353 0/3 (0%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 26/95 (27%)
Ig strand B 608..612 CDD:409353 2/3 (67%)
Ig strand C 623..627 CDD:409353 1/3 (33%)
Ig strand E 648..652 CDD:409353 1/3 (33%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 0/2 (0%)
FN3 686..789 CDD:238020 22/129 (17%)
FN3 798..893 CDD:238020 8/28 (29%)
FN3 901..1005 CDD:238020
FN3 <960..>1261 CDD:442628
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
MuskNP_112323.2 IgI_1_MuSK 28..117 CDD:409562 24/94 (26%)
Ig strand A 28..31 CDD:409562 1/2 (50%)
Ig strand A' 35..39 CDD:409562 2/3 (67%)
Ig strand B 45..52 CDD:409562 1/6 (17%)
Ig strand C 58..63 CDD:409562 1/4 (25%)
Ig strand C' 65..67 CDD:409562 0/1 (0%)
Ig strand D 75..78 CDD:409562 1/2 (50%)
Ig strand E 82..88 CDD:409562 1/5 (20%)
Ig strand F 95..102 CDD:409562 1/6 (17%)
Ig strand G 109..117 CDD:409562 2/9 (22%)
IgI_2_MuSK 122..209 CDD:409560 35/126 (28%)
Ig strand A 122..125 CDD:409560 1/2 (50%)
Ig strand A' 129..131 CDD:409560 1/1 (100%)
Ig strand B 137..145 CDD:409560 2/7 (29%)
Ig strand C 151..156 CDD:409560 1/4 (25%)
Ig strand C' 158..161 CDD:409560 0/2 (0%)
Ig strand D 166..170 CDD:409560 1/3 (33%)
Ig strand E 173..179 CDD:409560 3/5 (60%)
Ig strand F 186..194 CDD:409560 4/7 (57%)
Ig strand G 197..202 CDD:409560 3/8 (38%)
Ig strand G' 204..209 CDD:409560 1/4 (25%)
Ig 213..296 CDD:472250 24/88 (27%)
Ig strand B 229..233 CDD:409353 2/3 (67%)
Ig strand C 242..246 CDD:409353 1/3 (33%)
Ig strand E 268..272 CDD:409353 1/3 (33%)
Ig strand F 279..284 CDD:409353 2/4 (50%)
Ig strand G 292..295 CDD:409353 0/2 (0%)
CRD_TK_ROR_related 313..457 CDD:143578 22/147 (15%)
PTKc_Musk 568..857 CDD:133181
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.