DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and Robo4

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:XP_006510707.1 Gene:Robo4 / 74144 MGIID:1921394 Length:1074 Species:Mus musculus


Alignment Length:477 Identity:127/477 - (26%)
Similarity:189/477 - (39%) Gaps:106/477 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 SAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQ-ILESGDLLI---- 557
            |.|.:.:.||:........|.:.||:.|.|.|.|.|:.|...|...:..:. :|..|.||:    
Mouse    40 SPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPS 104

  Fly   558 --------SNIRSVDAGLYICVRANEAG-SVKGEAYLSVLVRTQIIQ-PPVDTTVLLGLTATLQC 612
                    .||.|...|:|.|..:|..| :|...|.|||.|..:..| .|.||..::|.:..|:|
Mouse   105 VQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLEC 169

  Fly   613 KVSSDPSVPY---NIDWYREGQSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGG-N 673
                .|...|   ::.|:::|:..  :....|..|..| .|.:.....:|.|:|.|:.|:..| .
Mouse   170 ----GPPWGYPKPSVSWWKDGKPL--VLQPGRRTVSGD-SLMVSRAEKNDSGTYMCMATNNAGQR 227

  Fly   674 ETRAARLSVIE-------LPFPPSNVKVERL----PEPQQ-----RSINVSWT---PGFDGNSPI 719
            |:||||:|:.|       |......:::|.:    |||.:     .|:.:||.   |.....|..
Mouse   228 ESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYT 292

  Fly   720 SKFIIQRREVSELGPVPDPLLNWITELSNVSADQRWILLENLKAATV--------YQFRVSAVNR 776
            :.|..||....:..|       | ||          :||..|::|.:        |:|:|    |
Mouse   293 ALFRTQRSPRDQGSP-------W-TE----------VLLRGLQSAKLGGLHWGQDYEFKV----R 335

  Fly   777 VGEGSPSEP-SNV--VELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRL 838
            ...|....| |||  :.||::.||.||.| |........:...|.||..|..||.|.||.:    
Mouse   336 PSSGRARGPDSNVLLLRLPEQVPSAPPQG-VTLRSGNGSVFVSWAPPPAESHNGVIRGYQV---- 395

  Fly   839 FGYNNVPWSYQNITNEAQRNFLIQELITWK-------DYIVQIAAYNNMGVGVYTEGSKIKTKEG 896
                   ||..|.:..|....::.|....:       .|.||:||....|.|..:....:...||
Mouse   396 -------WSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLGEG 453

  Fly   897 VPEAPPTNVKVEAINSTAARCR 918
                     |..:|:||...||
Mouse   454 ---------KALSISSTPPPCR 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046
Ig 280..344 CDD:409353
Ig strand B 280..283 CDD:409353
Ig strand C 292..298 CDD:409353
Ig strand E 319..323 CDD:409353
Ig strand F 333..338 CDD:409353
Ig 360..451 CDD:472250
Ig strand B 378..382 CDD:409353
Ig strand C 391..395 CDD:409353
Ig strand E 416..420 CDD:409353
Ig strand F 430..435 CDD:409353
Ig strand G 443..446 CDD:409353
Ig 502..587 CDD:472250 27/98 (28%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 530..534 CDD:409353 1/3 (33%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 26/94 (28%)
Ig strand B 608..612 CDD:409353 1/3 (33%)
Ig strand C 623..627 CDD:409353 0/3 (0%)
Ig strand E 648..652 CDD:409353 1/3 (33%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 1/2 (50%)
FN3 686..789 CDD:238020 29/125 (23%)
FN3 798..893 CDD:238020 25/101 (25%)
FN3 901..1005 CDD:238020 6/18 (33%)
FN3 <960..>1261 CDD:442628
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
Robo4XP_006510707.1 Ig 42..144 CDD:472250 29/101 (29%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig 151..236 CDD:472250 26/91 (29%)
Ig strand B 165..169 CDD:409353 1/3 (33%)
Ig strand C 179..183 CDD:409353 0/3 (0%)
Ig strand E 201..205 CDD:409353 2/4 (50%)
Ig strand F 215..220 CDD:409353 2/4 (50%)
Ig strand G 229..232 CDD:409353 1/2 (50%)
FN3 <267..>446 CDD:442628 54/212 (25%)
fn3 361..443 CDD:394996 25/93 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.